GGRNA ver.2 Home | Help | Advanced search    Previous release (v1)

2025-07-03 09:21:28, GGRNA.v2 : RefSeq release 229 (Mar, 2025)

LOCUS       XM_063865652             849 bp    mRNA    linear   INV 21-MAR-2024
DEFINITION  PREDICTED: Symsagittifera roscoffensis probable NADH dehydrogenase
            [ubiquinone] 1 alpha subcomplex subunit 12 (LOC134848265), mRNA.
ACCESSION   XM_063865652
VERSION     XM_063865652.1
DBLINK      BioProject: PRJNA1087286
KEYWORDS    RefSeq.
SOURCE      Symsagittifera roscoffensis
  ORGANISM  Symsagittifera roscoffensis
            Eukaryota; Metazoa; Xenacoelomorpha; Acoelomorpha; Acoela;
            Sagittiferidae; Symsagittifera.
COMMENT     MODEL REFSEQ:  This record is predicted by automated computational
            analysis. This record is derived from a genomic sequence
            (NC_087067) annotated using gene prediction method: Gnomon.
            Also see:
                Documentation of NCBI's Annotation Process
            
            ##Genome-Annotation-Data-START##
            Annotation Provider         :: NCBI RefSeq
            Annotation Status           :: Full annotation
            Annotation Name             :: GCF_963678635.1-RS_2024_03
            Annotation Pipeline         :: NCBI eukaryotic genome annotation
                                           pipeline
            Annotation Software Version :: 10.2
            Annotation Method           :: Gnomon; cmsearch; tRNAscan-SE
            Features Annotated          :: Gene; mRNA; CDS; ncRNA
            Annotation Date             :: 03/16/2024
            ##Genome-Annotation-Data-END##
FEATURES             Location/Qualifiers
     source          1..849
                     /organism="Symsagittifera roscoffensis"
                     /mol_type="mRNA"
                     /db_xref="taxon:84072"
                     /chromosome="6"
     gene            1..849
                     /gene="LOC134848265"
                     /note="probable NADH dehydrogenase [ubiquinone] 1 alpha
                     subcomplex subunit 12; Derived by automated computational
                     analysis using gene prediction method: Gnomon. Supporting
                     evidence includes similarity to: 5 Proteins"
                     /db_xref="GeneID:134848265"
     CDS             5..460
                     /gene="LOC134848265"
                     /codon_start=1
                     /product="probable NADH dehydrogenase [ubiquinone] 1 alpha
                     subcomplex subunit 12"
                     /protein_id="XP_063721722.1"
                     /db_xref="GeneID:134848265"
                     /translation="
MAEGKNLVSKFFNVIKHNGGVTGTFLKYCRGIEPKQGTLMGEDQFGNKYFENKNYFMARNRWVEFNPKPSDPAYGYFHFDASQIPPDWHRWMHHMTDQAPSEHPLPKQKFHMPHQPNYSGLNRSYTPFSTTTKKIHEWDPTTATSGSETNK"
     polyA_site      849
                     /gene="LOC134848265"
                     /experiment="COORDINATES: polyA evidence [ECO:0006239]"
ORIGIN      
gagtatggctgagggtaagaacttggtgagtaagttcttcaatgtgatcaagcacaatgggggagtaacgggcaccttcctcaagtactgcaggggcatcgagcccaaacagggaactctgatgggggaggaccagtttggaaacaagtacttcgaaaacaaaaattactttatggcccgcaaccggtgggtggagttcaaccctaagccctctgaccccgcctacggctacttccacttcgacgcctcccagatccccccggactggcacaggtggatgcaccacatgacagaccaagccccctctgaacaccccctccccaaacagaagttccacatgccccaccagcccaattacagtggactcaacaggtcttacacgcccttctcaaccacaaccaagaagatccacgaatgggaccccactacagccacttctggatcagaaacaaacaaataagatgaatagtattgactgatttgcagcaatgaaatattttaaaacaatttacttttacctggagaactaacttgaacgaaaagtcactccgtagtattttgtgttttctgggaatagttgaaatcatggcaatggatcttggtttgccgaggatcaggttgtttagttctgagcacagttatcgaagtatctacttttttcactctcaattttgatttttcacagttcgactattcatttctttttaagttcatttacttgttaaaaggaaggctagctccgctttcgaacagcaaatgtggaaaggtcccaaaaaacgtgatcgacttctagtttcgaagcagatttaatgtccagatttcccagcgtaattaaaaatttacctattg
//

by @meso_cacase at DBCLS
This page is licensed under a Creative Commons Attribution 4.0 International License (CC BY 4.0).

If you use GGRNA in your work, please cite:
Naito Y, Bono H. (2012)
GGRNA: an ultrafast, transcript-oriented search engine for genes and transcripts.
Nucleic Acids Res., 40, W592-W596. [Full Text]