GGRNA ver.2 Home | Help | Advanced search    Previous release (v1)

2024-09-08 08:45:55, GGRNA.v2 : RefSeq release 225 (Jul, 2024)

LOCUS       XM_063021626             300 bp    mRNA    linear   PLN 14-FEB-2024
DEFINITION  [Candida] saopauloensis uncharacterized protein (PUMCH_002625),
            partial mRNA.
ACCESSION   XM_063021626
VERSION     XM_063021626.1
DBLINK      BioProject: PRJNA1073831
            BioSample: SAMN37476331
KEYWORDS    RefSeq.
SOURCE      [Candida] saopauloensis
  ORGANISM  [Candida] saopauloensis
            Eukaryota; Fungi; Dikarya; Ascomycota; Saccharomycotina;
            Saccharomycetes; Saccharomycetales; Saccharomycetales incertae
            sedis; Candida/Saccharomycales clade.
REFERENCE   1  (bases 1 to 300)
  AUTHORS   Ning,Y., Dai,R., Xiao,M., Xu,Y., Yan,Q. and Zhang,L.
  TITLE     Draft Genome Sequence of Candida saopaulonensis from a very
            Premature Infant with Sepsis
  JOURNAL   Unpublished
REFERENCE   2  (bases 1 to 300)
  CONSRTM   NCBI Genome Project
  TITLE     Direct Submission
  JOURNAL   Submitted (14-FEB-2024) National Center for Biotechnology
            Information, NIH, Bethesda, MD 20894, USA
REFERENCE   3  (bases 1 to 300)
  AUTHORS   Ning,Y., Dai,R., Xiao,M., Xu,Y., Yan,Q. and Zhang,L.
  TITLE     Direct Submission
  JOURNAL   Submitted (29-OCT-2023) Clinical laboratory, Peking Union Medical
            College Hospital, 1 Shuaifuyuan, Beijing 100730, China
COMMENT     PROVISIONAL REFSEQ: This record has not yet been subject to final
            NCBI review. This record is derived from an annotated genomic
            sequence (NC_086133).
            COMPLETENESS: incomplete on both ends.
FEATURES             Location/Qualifiers
     source          1..300
                     /organism="[Candida] saopauloensis"
                     /mol_type="mRNA"
                     /strain="19XY460"
                     /isolation_source="blood culture obtained aseptically from
                     the catheter hub"
                     /host="Homo sapiens"
                     /db_xref="taxon:291208"
                     /chromosome="3"
                     /geo_loc_name="China: Changsha"
                     /lat_lon="28.22 N 112.99 E"
                     /collection_date="2019-06-03"
                     /collected_by="Yating Ning"
     gene            <1..>300
                     /locus_tag="PUMCH_002625"
                     /db_xref="GeneID:88173689"
     CDS             1..300
                     /locus_tag="PUMCH_002625"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_062877696.1"
                     /db_xref="GeneID:88173689"
                     /translation="
MARTGIAVGLNKGHKTTAKEVAPRRVNLKGRVSKRGAFVKSIVSEVSGLAPYERRLIELIRNAGEKRAKKLAKKRLGTHKRALKKVEEINTIIAESRRH"
ORIGIN      
atggctagaactggtatcgctgtcggattgaacaagggtcacaaaaccaccgccaaggaggtcgccccaagacgtgtcaacctcaagggccgtgtctccaagagaggtgctttcgttaagagcatcgtctctgaggtctccggtttggctccatacgagagaagattgatcgagttgatcagaaacgccggtgagaagagagccaagaagttggccaagaagagattgggtacccacaagagagctttgaagaaggttgaggagatcaacaccatcattgctgagtccagaagacactaa
//

by @meso_cacase at DBCLS
This page is licensed under a Creative Commons Attribution 4.0 International License (CC BY 4.0).

If you use GGRNA in your work, please cite:
Naito Y, Bono H. (2012)
GGRNA: an ultrafast, transcript-oriented search engine for genes and transcripts.
Nucleic Acids Res., 40, W592-W596. [Full Text]