2025-04-05 14:19:46, GGRNA.v2 : RefSeq release 228 (Jan, 2025)
LOCUS XM_062904406 900 bp mRNA linear PLN 07-FEB-2024 DEFINITION Trichoderma aggressivum f. europaeum uncharacterized protein (Triagg1_9447), partial mRNA. ACCESSION XM_062904406 VERSION XM_062904406.1 DBLINK BioProject: PRJNA1073605 BioSample: SAMN38060657 KEYWORDS RefSeq. SOURCE Trichoderma aggressivum f. europaeum ORGANISM Trichoderma aggressivum f. europaeum Eukaryota; Fungi; Dikarya; Ascomycota; Pezizomycotina; Sordariomycetes; Hypocreomycetidae; Hypocreales; Hypocreaceae; Trichoderma. REFERENCE 1 (bases 1 to 900) AUTHORS Beijen,E. and Ohm,R.A. TITLE The genome sequences of three competitors of mushroom-forming fungi JOURNAL Unpublished REFERENCE 2 (bases 1 to 900) CONSRTM NCBI Genome Project TITLE Direct Submission JOURNAL Submitted (06-FEB-2024) National Center for Biotechnology Information, NIH, Bethesda, MD 20894, USA REFERENCE 3 (bases 1 to 900) AUTHORS Beijen,E. and Ohm,R.A. TITLE Direct Submission JOURNAL Submitted (02-NOV-2023) Microbiology, Utrecht University, Padualaan 8, Utrecht 3524 CH, Netherlands COMMENT PROVISIONAL REFSEQ: This record has not yet been subject to final NCBI review. This record is derived from an annotated genomic sequence (NW_026946419). COMPLETENESS: incomplete on both ends. FEATURES Location/Qualifiers source 1..900 /organism="Trichoderma aggressivum f. europaeum" /mol_type="mRNA" /strain="CBS 100526" /isolation_source="Mushroom compost" /culture_collection="CBS:100526" /type_material="type material of Trichoderma aggressivum f. europaeum" /db_xref="taxon:173218" /chromosome="Unknown" /geo_loc_name="Ireland" /forma="europaeum" gene <1..>900 /locus_tag="Triagg1_9447" /note="proteinId:Triagg1|g9450.t1" /db_xref="GeneID:87924310" CDS 1..900 /locus_tag="Triagg1_9447" /note="proteinId:Triagg1|g9450.t1" /codon_start=1 /product="uncharacterized protein" /protein_id="XP_062751608.1" /db_xref="GeneID:87924310" /translation="
MKFNSAAIVAILAYTTLALPAPNGKMDVGKVDLVSRNGKMDVGKVDLERRNGKMDVGKVDLERRNGKMDVGKADLERRNGKMDVGKADLERRNGKMDVGKADLERRNGKMDVGKADLERRNGKMDVGKADLERRNGKMDVGKADLERRNGKMDVGKADLERRNGKMDVGKADLERRNGKMDVGKADLERRNGKMDVGKADLERRNGKMDVGKADLERRNGKMDVGKADLERRNGKMDVGKADLERRNGKMDVGKADLERRNGKMDVGKADLERRNGKMDVGKADLERRNGKMDVGKVDY"
ORIGIN
atgaagttcaactccgctgccattgtagccatcttggcctacaccaccttggctctgccagcgccaaacggcaagatggacgtcggcaaagtcgacctcgtgagccgcaacggcaagatggatgttggaaaagtcgaccttgaacgacgcaacggcaagatggatgttggaaaagtcgaccttgaacgacgcaacggcaagatggatgttggcaaagccgaccttgaacgacgcaacggcaagatggacgtcggaaaggctgatcttgaacgacgcaacggcaagatggacgtcggaaaggctgatcttgaacgacgcaacggcaagatggacgtcggcaaggctgatcttgaacgacgcaacggcaagatggacgtcggcaaggctgatcttgaacgacgaaatggcaagatggatgtcggcaaagccgacctcgagagacgtaacggcaagatggacgtcggcaaagccgaccttgaacgacgtaacggcaagatggacgtcggcaaggctgatcttgaacgacgcaacggcaagatggatgtcggcaaggctgaccttgaacgacgcaacggcaagatggatgtcggcaaggctgaccttgagcgacgcaacggcaagatggacgtcggaaaggctgatcttgaacgacgcaacggcaagatggacgtcggaaaggctgatcttgaacgacgcaacggcaagatggatgtcggcaaggctgaccttgagcgacgcaacggcaagatggacgtcggaaaggctgatcttgaacgacgcaacggcaagatggacgtcggaaaggctgaccttgaacgacgcaacggcaagatggacgtcggaaaggctgatcttgaacgacgcaacggcaagatggacgttggcaaggtggattactag
//
by
@meso_cacase at
DBCLS
This page is licensed under a
Creative Commons Attribution 4.0 International License (CC BY 4.0).
If you use GGRNA in your work, please cite:
Naito Y, Bono H. (2012)
GGRNA: an ultrafast, transcript-oriented search engine for genes and transcripts.
Nucleic Acids Res., 40, W592-W596.
[Full Text]