2025-07-04 00:37:52, GGRNA.v2 : RefSeq release 229 (Mar, 2025)
LOCUS XM_055279432 1237 bp mRNA linear PRI 17-JUL-2024 DEFINITION PREDICTED: Symphalangus syndactylus claudin 17 (CLDN17), mRNA. ACCESSION XM_055279432 VERSION XM_055279432.1 DBLINK BioProject: PRJNA946760 KEYWORDS RefSeq. SOURCE Symphalangus syndactylus (siamang) ORGANISM Symphalangus syndactylus Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hylobatidae; Symphalangus. COMMENT MODEL REFSEQ: This record is predicted by automated computational analysis. This record is derived from a genomic sequence (NC_072427) annotated using gene prediction method: Gnomon, supported by mRNA evidence. Also see: Documentation of NCBI's Annotation Process ##Genome-Annotation-Data-START## Annotation Provider :: NCBI RefSeq Annotation Status :: Updated annotation Annotation Name :: GCF_028878055.3-RS_2024_07 Annotation Pipeline :: NCBI eukaryotic genome annotation pipeline Annotation Software Version :: 10.3 Annotation Method :: Gnomon; cmsearch; tRNAscan-SE Features Annotated :: Gene; mRNA; CDS; ncRNA Annotation Date :: 07/16/2024 ##Genome-Annotation-Data-END## FEATURES Location/Qualifiers source 1..1237 /organism="Symphalangus syndactylus" /mol_type="mRNA" /isolate="Jambi" /db_xref="taxon:9590" /chromosome="5" /sex="male" /cell_line="Jambi" /cell_type="lymphoblastoid" /tissue_type="blood" gene 1..1237 /gene="CLDN17" /note="claudin 17; Derived by automated computational analysis using gene prediction method: Gnomon. Supporting evidence includes similarity to: 1 mRNA, 2 Proteins" /db_xref="GeneID:129482893" CDS 189..863 /gene="CLDN17" /codon_start=1 /product="claudin-17" /protein_id="XP_055135407.1" /db_xref="GeneID:129482893" /translation="
MAFYPLQIAGLVLGFLGMVGTLATTLLPQWRVSAFVGSNIIVFERLWEGLWMNCIRQARVRLQCKFYSSLLALPPALETARALMCVAVALSLIALLIGICGMKQVQCTGSNERAKAYLLGTSGVLFILTGIFVLIPVSWTANIIIRDFYNPAIHTGQKRELGAALFLGWASAAVLFIGGGLLCGFCCCNRKKQGYRYPVPGYCVPHTDKRRNRTMLSKTSTSYV"
ORIGIN
atgcatttacaacaggtacttctagttaggccaagttcagtcacagctactgatttggactaaaacgttatgggcagcagccaagaagaacatcatcaaagacttctctagactcaagaggcttccacgttctacatcttgagcatcttctaccactccgaattgaaccagtcttcaaagtaaaggcaatggcattttatcccttgcaaattgctgggctggttcttgggttccttggcatggtggggactcttgccacaacccttctgcctcagtggagagtatcagcttttgttggcagcaacatcattgtctttgagaggctctgggaagggctctggatgaactgcatccgacaagccagggtccggttgcaatgcaagttctatagttccttgttggctctcccgcctgccctggaaacagcccgggccctcatgtgtgtggctgttgctctctccttgatcgccctacttattggcatctgtggcatgaagcaggtccagtgcacaggctctaacgagagggccaaagcataccttctgggaacttcaggagtcctcttcatcctgacgggcatcttcgttctgattccggtgagctggacagccaatataatcatcagagatttttacaacccagccattcacacaggtcagaaacgagagctgggagcagcacttttccttggctgggcaagcgctgctgtcctcttcattggagggggtctgctttgtggattttgctgctgtaacagaaagaaacaagggtacagatatccagtgcctggctactgtgtgccacacacagataagcgaagaaacaggacaatgcttagtaagacctccaccagttatgtctaatgccctcttttggctccaagtatggactacggtcaatgttttttataaagtgctgctagaaactgtaagtatgtgaggcaggagaacttgctttatgtctagatttaaactgatatgaaagtttcaatttgttactggtggtaggaatggaaatgacttacttggacattctgacttcaggtgtattaaatgcattgactattgttggactcaatcgctgttccaattttcatattctaaattcaagtatacccataatcattggcaagtgtacaatgatggactactactttttgaccatcatatattatctgataagaatctaaagttgaaattgatactctataacaataaaacatatacctattctaaaa
//
by
@meso_cacase at
DBCLS
This page is licensed under a
Creative Commons Attribution 4.0 International License (CC BY 4.0).
If you use GGRNA in your work, please cite:
Naito Y, Bono H. (2012)
GGRNA: an ultrafast, transcript-oriented search engine for genes and transcripts.
Nucleic Acids Res., 40, W592-W596.
[Full Text]