GGRNA ver.2 Home | Help | Advanced search    Previous release (v1)

2025-07-04 02:25:01, GGRNA.v2 : RefSeq release 229 (Mar, 2025)

LOCUS       XM_050784731            1224 bp    mRNA    linear   PRI 26-FEB-2023
DEFINITION  PREDICTED: Macaca thibetana thibetana claudin 17 (CLDN17), mRNA.
ACCESSION   XM_050784731
VERSION     XM_050784731.1
DBLINK      BioProject: PRJNA873043
KEYWORDS    RefSeq.
SOURCE      Macaca thibetana thibetana
  ORGANISM  Macaca thibetana thibetana
            Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
            Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini;
            Catarrhini; Cercopithecidae; Cercopithecinae; Macaca.
COMMENT     MODEL REFSEQ:  This record is predicted by automated computational
            analysis. This record is derived from a genomic sequence
            (NC_065580) annotated using gene prediction method: Gnomon,
            supported by mRNA evidence.
            Also see:
                Documentation of NCBI's Annotation Process
            
            ##Genome-Annotation-Data-START##
            Annotation Provider         :: NCBI RefSeq
            Annotation Status           :: Updated annotation
            Annotation Name             :: GCF_024542745.1-RS_2023_02
            Annotation Pipeline         :: NCBI eukaryotic genome annotation
                                           pipeline
            Annotation Software Version :: 10.1
            Annotation Method           :: Gnomon; cmsearch; tRNAscan-SE
            Features Annotated          :: Gene; mRNA; CDS; ncRNA
            Annotation Date             :: 02/26/2023
            ##Genome-Annotation-Data-END##
FEATURES             Location/Qualifiers
     source          1..1224
                     /organism="Macaca thibetana thibetana"
                     /mol_type="mRNA"
                     /isolate="TM-01"
                     /sub_species="thibetana"
                     /db_xref="taxon:257877"
                     /chromosome="3"
                     /sex="male"
                     /tissue_type="peripheral blood"
     gene            1..1224
                     /gene="CLDN17"
                     /note="claudin 17; Derived by automated computational
                     analysis using gene prediction method: Gnomon. Supporting
                     evidence includes similarity to: 3 mRNAs, 2 Proteins"
                     /db_xref="GeneID:126950741"
     CDS             190..864
                     /gene="CLDN17"
                     /codon_start=1
                     /product="claudin-17"
                     /protein_id="XP_050640688.1"
                     /db_xref="GeneID:126950741"
                     /translation="
MAFYPLQIAGLVLGFLGMVGTLATTLLPQWRVSAFVGSNIIVFERLWEGLWMNCIRQARARLQCKFYSSLLALPPVLETARALMCVAVALSLIALLIGICGMKQVQCTGSNERAKAYLLGTSGVLFILTGIFVLIPVSWTANVIIRDFYNPAVHIGQKRELGAALFLGWASAAVLFIGGGLLCGFCCCNRKKQRYRYPVPGHCVPHTDKRRNMKMPSNTSTSYV"
     misc_feature    205..735
                     /gene="CLDN17"
                     /note="PMP-22/EMP/MP20/Claudin family; Region:
                     PMP22_Claudin; cl21598"
                     /db_xref="CDD:473919"
ORIGIN      
atgcatttacaacaggtacttctagttaggccaagttcagtcacagccactgatttggactaaaatgatatgggcagcagccaaggagaacatcatcaaagacttctctagactcaagagccttccacattctacatcttgagcatcttctaccactccgaattggactagtcttcaaagtaaaaggcaatggcattttatcccttgcaaattgctgggctggttcttgggttccttggcatggtggggactcttgccacgacgcttctgcctcagtggagagtatcagcttttgttggcagcaacattattgtctttgagaggctctgggaagggctctggatgaactgcatccgacaagccagggcccggttgcaatgcaagttctatagttcattgttggctcttccgcctgtcctggaaacagcccgggcactcatgtgtgtggctgttgctctctccttgatcgccctacttattggcatctgtggcatgaagcaggtccagtgcacgggctctaatgagagggccaaagcatatcttctgggaacttcaggagtcctcttcatcctgacaggcatcttcgttctgattccggtgagctggacagccaatgtaatcatcagagatttctacaacccagctgtccacataggtcagaaacgagagctgggagcagcacttttccttggctgggcaagcgctgctgtcctcttcattggaggcggtctgctttgtggattttgctgctgcaacagaaagaagcaaaggtacagatatccagtgcctggccactgtgtgccacacacagataagcgaagaaacatgaaaatgcctagtaatacctccaccagttatgtctaatgcctgcttttggctccaagtgtggactatggtcaatgtttgttataaagtcctgctagaaactgtaagtatgtgaggcaggagaacttgctttatgtctagatttaaattgatatgaaagtttcaatttgttactggtaggaaaacttggacattctgacttcaggtgtattaaatgcatttactattgttggactcaatcgctgttccaatgttcatattctaaatgtaagtatacccataatcattatcaagtgcacaatgatggactactagtttttgaccatcatattttatctgataagaatcaaaatttgaaatcgatattctataacaataaaacatatacctattctaaaa
//

by @meso_cacase at DBCLS
This page is licensed under a Creative Commons Attribution 4.0 International License (CC BY 4.0).

If you use GGRNA in your work, please cite:
Naito Y, Bono H. (2012)
GGRNA: an ultrafast, transcript-oriented search engine for genes and transcripts.
Nucleic Acids Res., 40, W592-W596. [Full Text]