2025-07-04 02:25:01, GGRNA.v2 : RefSeq release 229 (Mar, 2025)
LOCUS XM_050784731 1224 bp mRNA linear PRI 26-FEB-2023 DEFINITION PREDICTED: Macaca thibetana thibetana claudin 17 (CLDN17), mRNA. ACCESSION XM_050784731 VERSION XM_050784731.1 DBLINK BioProject: PRJNA873043 KEYWORDS RefSeq. SOURCE Macaca thibetana thibetana ORGANISM Macaca thibetana thibetana Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Cercopithecidae; Cercopithecinae; Macaca. COMMENT MODEL REFSEQ: This record is predicted by automated computational analysis. This record is derived from a genomic sequence (NC_065580) annotated using gene prediction method: Gnomon, supported by mRNA evidence. Also see: Documentation of NCBI's Annotation Process ##Genome-Annotation-Data-START## Annotation Provider :: NCBI RefSeq Annotation Status :: Updated annotation Annotation Name :: GCF_024542745.1-RS_2023_02 Annotation Pipeline :: NCBI eukaryotic genome annotation pipeline Annotation Software Version :: 10.1 Annotation Method :: Gnomon; cmsearch; tRNAscan-SE Features Annotated :: Gene; mRNA; CDS; ncRNA Annotation Date :: 02/26/2023 ##Genome-Annotation-Data-END## FEATURES Location/Qualifiers source 1..1224 /organism="Macaca thibetana thibetana" /mol_type="mRNA" /isolate="TM-01" /sub_species="thibetana" /db_xref="taxon:257877" /chromosome="3" /sex="male" /tissue_type="peripheral blood" gene 1..1224 /gene="CLDN17" /note="claudin 17; Derived by automated computational analysis using gene prediction method: Gnomon. Supporting evidence includes similarity to: 3 mRNAs, 2 Proteins" /db_xref="GeneID:126950741" CDS 190..864 /gene="CLDN17" /codon_start=1 /product="claudin-17" /protein_id="XP_050640688.1" /db_xref="GeneID:126950741" /translation="
MAFYPLQIAGLVLGFLGMVGTLATTLLPQWRVSAFVGSNIIVFERLWEGLWMNCIRQARARLQCKFYSSLLALPPVLETARALMCVAVALSLIALLIGICGMKQVQCTGSNERAKAYLLGTSGVLFILTGIFVLIPVSWTANVIIRDFYNPAVHIGQKRELGAALFLGWASAAVLFIGGGLLCGFCCCNRKKQRYRYPVPGHCVPHTDKRRNMKMPSNTSTSYV"
misc_feature 205..735 /gene="CLDN17" /note="PMP-22/EMP/MP20/Claudin family; Region: PMP22_Claudin; cl21598" /db_xref="CDD:473919" ORIGIN
atgcatttacaacaggtacttctagttaggccaagttcagtcacagccactgatttggactaaaatgatatgggcagcagccaaggagaacatcatcaaagacttctctagactcaagagccttccacattctacatcttgagcatcttctaccactccgaattggactagtcttcaaagtaaaaggcaatggcattttatcccttgcaaattgctgggctggttcttgggttccttggcatggtggggactcttgccacgacgcttctgcctcagtggagagtatcagcttttgttggcagcaacattattgtctttgagaggctctgggaagggctctggatgaactgcatccgacaagccagggcccggttgcaatgcaagttctatagttcattgttggctcttccgcctgtcctggaaacagcccgggcactcatgtgtgtggctgttgctctctccttgatcgccctacttattggcatctgtggcatgaagcaggtccagtgcacgggctctaatgagagggccaaagcatatcttctgggaacttcaggagtcctcttcatcctgacaggcatcttcgttctgattccggtgagctggacagccaatgtaatcatcagagatttctacaacccagctgtccacataggtcagaaacgagagctgggagcagcacttttccttggctgggcaagcgctgctgtcctcttcattggaggcggtctgctttgtggattttgctgctgcaacagaaagaagcaaaggtacagatatccagtgcctggccactgtgtgccacacacagataagcgaagaaacatgaaaatgcctagtaatacctccaccagttatgtctaatgcctgcttttggctccaagtgtggactatggtcaatgtttgttataaagtcctgctagaaactgtaagtatgtgaggcaggagaacttgctttatgtctagatttaaattgatatgaaagtttcaatttgttactggtaggaaaacttggacattctgacttcaggtgtattaaatgcatttactattgttggactcaatcgctgttccaatgttcatattctaaatgtaagtatacccataatcattatcaagtgcacaatgatggactactagtttttgaccatcatattttatctgataagaatcaaaatttgaaatcgatattctataacaataaaacatatacctattctaaaa
//
by
@meso_cacase at
DBCLS
This page is licensed under a
Creative Commons Attribution 4.0 International License (CC BY 4.0).
If you use GGRNA in your work, please cite:
Naito Y, Bono H. (2012)
GGRNA: an ultrafast, transcript-oriented search engine for genes and transcripts.
Nucleic Acids Res., 40, W592-W596.
[Full Text]