2025-07-03 09:24:11, GGRNA.v2 : RefSeq release 229 (Mar, 2025)
LOCUS XM_050517481 796 bp mRNA linear PLN 03-APR-2024 DEFINITION PREDICTED: Argentina anserina uncharacterized LOC126791077 (LOC126791077), mRNA. ACCESSION XM_050517481 VERSION XM_050517481.1 DBLINK BioProject: PRJNA874680 KEYWORDS RefSeq. SOURCE Argentina anserina (silverweed cinquefoil) ORGANISM Argentina anserina Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta; Spermatophyta; Magnoliopsida; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Rosaceae; Rosoideae; Potentilleae; Potentilleae incertae sedis; Argentina. COMMENT MODEL REFSEQ: This record is predicted by automated computational analysis. This record is derived from a genomic sequence (NC_065875) annotated using gene prediction method: Gnomon. Also see: Documentation of NCBI's Annotation Process ##Genome-Annotation-Data-START## Annotation Provider :: NCBI RefSeq Annotation Status :: Updated annotation Annotation Name :: GCF_933775445.1-RS_2024_04 Annotation Pipeline :: NCBI eukaryotic genome annotation pipeline Annotation Software Version :: 10.2 Annotation Method :: Gnomon; cmsearch; tRNAscan-SE Features Annotated :: Gene; mRNA; CDS; ncRNA Annotation Date :: 04/02/2024 ##Genome-Annotation-Data-END## FEATURES Location/Qualifiers source 1..796 /organism="Argentina anserina" /mol_type="mRNA" /db_xref="taxon:57926" /chromosome="4" gene 1..796 /gene="LOC126791077" /note="uncharacterized LOC126791077; Derived by automated computational analysis using gene prediction method: Gnomon. Supporting evidence includes similarity to: 26 Proteins" /db_xref="GeneID:126791077" CDS 180..683 /gene="LOC126791077" /codon_start=1 /product="uncharacterized protein LOC126791077" /protein_id="XP_050373438.1" /db_xref="GeneID:126791077" /translation="
MAEVAAAASSSSSSSSIFTNYPLLSALIAFALAQFIKLFTAWYKERRWDIKQLVGSGGMPSSHSATVTAIAAAIVFQEGVGGSLFAIALILACVVMYDATGVRLQAGRQAEVLNQIVYELPSEHPLAESRPLRELLGHTPPQVIAGGILGVVTATIGHLIILATSHI"
misc_feature 231..638 /gene="LOC126791077" /note="Divergent PAP2 family; Region: DUF212; pfam02681" /db_xref="CDD:426924" polyA_site 796 /gene="LOC126791077" /experiment="COORDINATES: polyA evidence [ECO:0006239]" ORIGIN
ccaagaaaccaaagacctgactcggccatagctccaagaaacaagcctaccacaacaaagaacccacctttacattcataaaacgacacccaccaagctaaacccttctcaattctcacgtccatttcagatttcagcttctgggttttgatcatattggaatttcacctcagaaagagatggccgaggtggcggcagctgcgtcttcttcttcttcttcgtcttcaatcttcaccaactaccctcttctctctgctctcatagctttcgctctcgcccaattcatcaagctcttcaccgcctggtacaaggaaagaagatgggatattaagcaacttgttgggtctggcggaatgccatcatctcattctgcgactgttactgctattgctgcggcaatagtgtttcaagagggtgttggtggatcactctttgcaattgcactgatattagcatgtgttgtgatgtatgatgcaaccggtgtaagattacaggctggacgccaagcagaggttttgaatcaaattgtgtatgaacttccttctgagcatcctcttgccgagagcagaccacttcgtgaacttcttggccacacaccccctcaggttattgctggtggaattcttggtgttgtcacagcaaccattggccatttgataatcttggctacgagtcatatatgatgccccaatgggtttaacatccgtataaatagtgattacaatttaacagggtttcttattgtcacatctcctgttatacgtttgcattgcacatttgcagatccctcatcaaa
//
by
@meso_cacase at
DBCLS
This page is licensed under a
Creative Commons Attribution 4.0 International License (CC BY 4.0).
If you use GGRNA in your work, please cite:
Naito Y, Bono H. (2012)
GGRNA: an ultrafast, transcript-oriented search engine for genes and transcripts.
Nucleic Acids Res., 40, W592-W596.
[Full Text]