GGRNA ver.2 Home | Help | Advanced search    Previous release (v1)

2025-08-20 18:58:55, GGRNA.v2 : RefSeq release 230 (May, 2025)

LOCUS       XM_047904168             210 bp    mRNA    linear   PLN 11-SEP-2023
DEFINITION  Fulvia fulva uncharacterized protein (CLAFUR5_05020), partial mRNA.
ACCESSION   XM_047904168
VERSION     XM_047904168.1
DBLINK      BioProject: PRJNA801200
            BioSample: SAMN12769558
KEYWORDS    RefSeq.
SOURCE      Fulvia fulva
  ORGANISM  Fulvia fulva
            Eukaryota; Fungi; Dikarya; Ascomycota; Pezizomycotina;
            Dothideomycetes; Dothideomycetidae; Mycosphaerellales;
            Mycosphaerellaceae; Fulvia.
REFERENCE   1  (bases 1 to 210)
  AUTHORS   Zaccaron,A.Z., Chen,L.H., Samaras,A. and Stergiopoulos,I.
  TITLE     A chromosome-scale genome assembly of the tomato pathogen
            Cladosporium fulvum reveals a compartmentalized genome architecture
            and the presence of a dispensable chromosome
  JOURNAL   Microb Genom 8 (4) (2022)
   PUBMED   35471194
REFERENCE   2  (bases 1 to 210)
  CONSRTM   NCBI Genome Project
  TITLE     Direct Submission
  JOURNAL   Submitted (11-SEP-2023) National Center for Biotechnology
            Information, NIH, Bethesda, MD 20894, USA
REFERENCE   3  (bases 1 to 210)
  AUTHORS   Zaccaron,A. and Stergiopoulos,I.
  TITLE     Direct Submission
  JOURNAL   Submitted (19-DEC-2021) Department of Plant Pathology, University
            of California, 1 Shields Ave, Davis, CA 95616, USA
REFERENCE   4  (bases 1 to 210)
  AUTHORS   Zaccaron,A. and Stergiopoulos,I.
  TITLE     Direct Submission
  JOURNAL   Submitted (27-SEP-2021) Department of Plant Pathology, University
            of California, 1 Shields Ave, Davis, CA 95616, USA
COMMENT     PROVISIONAL REFSEQ: This record has not yet been subject to final
            NCBI review. This record is derived from an annotated genomic
            sequence (NC_063015).
            COMPLETENESS: incomplete on both ends.
FEATURES             Location/Qualifiers
     source          1..210
                     /organism="Fulvia fulva"
                     /mol_type="mRNA"
                     /strain="Race5_Kim"
                     /host="Solanum lycopersicum"
                     /db_xref="taxon:5499"
                     /chromosome="4"
                     /geo_loc_name="France"
                     /collection_date="1979"
     gene            <1..>210
                     /locus_tag="CLAFUR5_05020"
                     /db_xref="GeneID:71984898"
     CDS             1..210
                     /locus_tag="CLAFUR5_05020"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_047760120.1"
                     /db_xref="GeneID:71984898"
                     /db_xref="GO:0005783"
                     /db_xref="InterPro:IPR010580"
                     /db_xref="PFAM:PF06624"
                     /translation="
MAQTPQQRKANAAFAKKQEAKMGKPESSLPVKKEKKEKPPISPFWVYTLIFVVCGGLIFELLRMIAGYF"
     misc_feature    4..186
                     /locus_tag="CLAFUR5_05020"
                     /note="Ribosome associated membrane protein RAMP4; Region:
                     RAMP4; pfam06624"
                     /db_xref="CDD:461965"
ORIGIN      
atggcccaaactccccaacaacggaaagccaacgcggcctttgcgaagaagcaggaagcgaagatgggaaagccagaatcgagcttacccgtaaagaaggagaagaaggagaagccaccgattagtcccttctgggtttacacactcatcttcgtcgtttgcggtggcctgatattcgaactcctgaggatgattgctgggtacttctag
//

by @meso_cacase at DBCLS
This page is licensed under a Creative Commons Attribution 4.0 International License (CC BY 4.0).

If you use GGRNA in your work, please cite:
Naito Y, Bono H. (2012)
GGRNA: an ultrafast, transcript-oriented search engine for genes and transcripts.
Nucleic Acids Res., 40, W592-W596. [Full Text]