2025-10-16 18:11:42, GGRNA.v2 : RefSeq release 232 (Sep, 2025)
LOCUS XM_043278441 231 bp mRNA linear PLN 22-FEB-2025 DEFINITION Aspergillus chevalieri uncharacterized protein (ACHE_40262A), partial mRNA. ACCESSION XM_043278441 VERSION XM_043278441.1 DBLINK BioProject: PRJNA727462 BioSample: SAMD00269937 Sequence Read Archive: DRR262018, DRR262019, DRR262020 KEYWORDS RefSeq. SOURCE Aspergillus chevalieri ORGANISM Aspergillus chevalieri Eukaryota; Fungi; Dikarya; Ascomycota; Pezizomycotina; Eurotiomycetes; Eurotiomycetidae; Eurotiales; Aspergillaceae; Aspergillus; Aspergillus subgen. Aspergillus. REFERENCE 1 AUTHORS Kadooka,C., Mori,K. and Futagami,T. TITLE Aspergillus chevalieri M1 genome sequence JOURNAL Unpublished REFERENCE 2 (bases 1 to 231) CONSRTM NCBI Genome Project TITLE Direct Submission JOURNAL Submitted (22-FEB-2025) National Center for Biotechnology Information, NIH, Bethesda, MD 20894, USA REFERENCE 3 (bases 1 to 231) AUTHORS Kazuki,M. and Futagami,T. CONSRTM Aspergillus chevalieri M1 genome sequencing consortium TITLE Direct Submission JOURNAL Submitted (28-JAN-2021) Contact:Taiki Futagami Kagoshima University, Agriculture; Korimoto 1-21-24, Kagoshima, Kagoshima 890-0065, Japan COMMENT PROVISIONAL REFSEQ: This record has not yet been subject to final NCBI review. This record is derived from an annotated genomic sequence (NC_057365). COMPLETENESS: incomplete on both ends. FEATURES Location/Qualifiers source 1..231 /organism="Aspergillus chevalieri" /mol_type="mRNA" /strain="M1" /db_xref="taxon:182096" /chromosome="4" /geo_loc_name="Japan:Kagoshima, Makurazaki" /collection_date="2018" gene <1..>231 /locus_tag="ACHE_40262A" /db_xref="GeneID:66982057" CDS 1..231 /locus_tag="ACHE_40262A" /note="COG:S; EggNog:ENOG410PTK3; InterPro:IPR010580; PFAM:PF06624; TransMembrane:1 (o42-63i); go_component: GO:0005783 - endoplasmic reticulum [Evidence IEA]" /codon_start=1 /product="uncharacterized protein" /protein_id="XP_043136220.1" /db_xref="GeneID:66982057" /translation="
MTQTPKQRKANEKYAKNEAAKRGKGQLPVKQKPSAKSSLPTGWLAVLIFVICGGLAFELLGVIPKLWSATFGRFMD"
misc_feature 7..180 /locus_tag="ACHE_40262A" /note="Ribosome associated membrane protein RAMP4; Region: RAMP4; pfam06624" /db_xref="CDD:461965" ORIGIN
atgacacagacaccgaaacagcgaaaagcaaatgagaagtacgcaaagaatgaggctgcaaaacgagggaagggtcagctgccggtcaagcaaaaaccaagcgccaagtcttctttgcccactggctggctagccgttctcatcttcgttatatgcggtggacttgcattcgaactcctaggtgtcattccaaagctatggtcagcaacgtttggtcggttcatggactag
//
by
@meso_cacase at
DBCLS
This page is licensed under a
Creative Commons Attribution 4.0 International License (CC BY 4.0).
If you use GGRNA in your work, please cite:
Naito Y, Bono H. (2012)
GGRNA: an ultrafast, transcript-oriented search engine for genes and transcripts.
Nucleic Acids Res., 40, W592-W596.
[Full Text]