GGRNA ver.2 Home | Help | Advanced search    Previous release (v1)

2024-04-26 09:36:48, GGRNA.v2 : RefSeq release 222 (Jan, 2024)

LOCUS       XM_043020845             388 bp    mRNA    linear   INV 16-AUG-2021
DEFINITION  PREDICTED: Penaeus japonicus uncharacterized LOC122256289
            (LOC122256289), mRNA.
ACCESSION   XM_043020845
VERSION     XM_043020845.1
DBLINK      BioProject: PRJNA752636
KEYWORDS    RefSeq; includes ab initio.
SOURCE      Penaeus japonicus
  ORGANISM  Penaeus japonicus
            Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Crustacea;
            Multicrustacea; Malacostraca; Eumalacostraca; Eucarida; Decapoda;
            Dendrobranchiata; Penaeoidea; Penaeidae; Penaeus.
COMMENT     MODEL REFSEQ:  This record is predicted by automated computational
            analysis. This record is derived from a genomic sequence
            (NW_025031402.1) annotated using gene prediction method: Gnomon.
            Also see:
                Documentation of NCBI's Annotation Process
            
            ##Genome-Annotation-Data-START##
            Annotation Provider         :: NCBI
            Annotation Status           :: Full annotation
            Annotation Name             :: Penaeus japonicus Annotation Release
                                           100
            Annotation Version          :: 100
            Annotation Pipeline         :: NCBI eukaryotic genome annotation
                                           pipeline
            Annotation Software Version :: 9.0
            Annotation Method           :: Best-placed RefSeq; Gnomon
            Features Annotated          :: Gene; mRNA; CDS; ncRNA
            ##Genome-Annotation-Data-END##
            
            ##RefSeq-Attributes-START##
            ab initio :: 9% of CDS bases
            ##RefSeq-Attributes-END##
FEATURES             Location/Qualifiers
     source          1..388
                     /organism="Penaeus japonicus"
                     /mol_type="mRNA"
                     /isolate="Ginoza2017"
                     /db_xref="taxon:27405"
                     /chromosome="Unknown"
                     /country="Japan:Okinawa"
                     /collection_date="2017"
     gene            1..388
                     /gene="LOC122256289"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Gnomon. Supporting evidence
                     includes similarity to: 90% coverage of the annotated
                     genomic feature by RNAseq alignments"
                     /db_xref="GeneID:122256289"
     CDS             29..388
                     /gene="LOC122256289"
                     /codon_start=1
                     /product="uncharacterized protein LOC122256289"
                     /protein_id="XP_042876779.1"
                     /db_xref="GeneID:122256289"
                     /translation="
MAMQSDAEFFFVGSSVNYTCPEKTMSSDGSTYTTITYNATGWSPIDPNFQCLNICLGDPPTAPPFVSSDFAGARAWGTVVTYTCQFAFRGAGAEVTVTCDEGSWWPNSLPACIGIIRGR"
     misc_feature    <50..367
                     /gene="LOC122256289"
                     /note="secreted complement-binding protein; Provisional;
                     Region: PHA02927"
                     /db_xref="CDD:222943"
ORIGIN      
ccctcctccgccacctccgtcaggcatcatggccatgcagtcggacgctgaattcttcttcgtcggttcttccgtcaactacacatgccccgaaaagaccatgtcctccgacggctctacctacacgacaattacttacaatgccacaggctggtccccgatcgatcccaatttccaatgtttgaacatatgccttggagacccgcccacagcgccgcccttcgtcagcagcgacttcgccggagcgagggcgtggggaaccgtggtcacctacacctgccagtttgcgttccggggagcaggagccgaggtcacggtgacctgcgacgagggatcctggtggcccaactctctccccgcctgcataggaataattagaggcagatga
//

by @meso_cacase at DBCLS
This page is licensed under a Creative Commons Attribution 4.0 International License (CC BY 4.0).

If you use GGRNA in your work, please cite:
Naito Y, Bono H. (2012)
GGRNA: an ultrafast, transcript-oriented search engine for genes and transcripts.
Nucleic Acids Res., 40, W592-W596. [Full Text]