LOCUS       XM_042366601             735 bp    mRNA    linear   INV 16-JUL-2021
DEFINITION  PREDICTED: Homarus americanus uncharacterized LOC121866866
            (LOC121866866), mRNA.
ACCESSION   XM_042366601
VERSION     XM_042366601.1
DBLINK      BioProject: PRJNA744898
KEYWORDS    RefSeq; includes ab initio.
SOURCE      Homarus americanus (American lobster)
  ORGANISM  Homarus americanus
            Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Crustacea;
            Multicrustacea; Malacostraca; Eumalacostraca; Eucarida; Decapoda;
            Pleocyemata; Astacidea; Nephropoidea; Nephropidae; Homarus.
COMMENT     MODEL REFSEQ:  This record is predicted by automated computational
            analysis. This record is derived from a genomic sequence
            (NW_024729998.1) annotated using gene prediction method: Gnomon.
            Also see:
                Documentation of NCBI's Annotation Process
            
            ##Genome-Annotation-Data-START##
            Annotation Provider         :: NCBI
            Annotation Status           :: Full annotation
            Annotation Name             :: Homarus americanus Annotation
                                           Release 100
            Annotation Version          :: 100
            Annotation Pipeline         :: NCBI eukaryotic genome annotation
                                           pipeline
            Annotation Software Version :: 9.0
            Annotation Method           :: Best-placed RefSeq; Gnomon
            Features Annotated          :: Gene; mRNA; CDS; ncRNA
            ##Genome-Annotation-Data-END##
            
            ##RefSeq-Attributes-START##
            ab initio :: 100% of CDS bases
            ##RefSeq-Attributes-END##
FEATURES             Location/Qualifiers
     source          1..735
                     /organism="Homarus americanus"
                     /mol_type="mRNA"
                     /isolate="GMGI-L3"
                     /isolation_source="marine"
                     /db_xref="taxon:6706"
                     /chromosome="Unknown"
                     /sex="male"
                     /tissue_type="heart & testis"
                     /geo_loc_name="USA: Gloucester, Massachusetts"
                     /collection_date="2015"
     gene            1..735
                     /gene="LOC121866866"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Gnomon. Supporting evidence
                     includes similarity to: 1 Protein"
                     /db_xref="GeneID:121866866"
     CDS             1..735
                     /gene="LOC121866866"
                     /codon_start=1
                     /product="uncharacterized protein LOC121866866"
                     /protein_id="XP_042222535.1"
                     /db_xref="GeneID:121866866"
                     /translation="

MITRESLGVSMIICESLGVIMITRESLGVIMITRESLGVIMIICESLGVIMIICESLGVIMNICESLSVIMITRESLGVIMIICESLGVIMNICESLSVIMITRESLGVIMIICESLGVIMNICESLSVIMITRESLGVIMITRESLGVIMIICESLSVIMITRESLGVIMNICESLSVIMITRESLGVIMITRESLGVIMITRESLGVIMITRESLGVIMITRESLSFYHMVLLPPLSHSVSL"

ORIGIN      

atgatcacccgtgagtcacttggtgtcagtatgatcatctgtgagtcactcggtgtcattatgatcacccgtgagtcactcggtgtcattatgatcacccgtgagtcacttggtgtcattatgatcatctgtgagtcactcggtgtcattatgatcatctgtgagtcactcggtgtcattatgaacatctgtgagtcactcagtgtcattatgatcacccgtgagtcactcggtgtcattatgatcatctgtgagtcactcggtgtcattatgaacatctgtgagtcactcagtgtcattatgatcacccgtgagtcactcggcgtcattatgatcatctgtgagtcactcggtgtcattatgaacatctgtgagtcactcagtgtcattatgatcacccgtgagtcactcggtgtcattatgatcacccgtgagtcacttggtgtcattatgatcatctgtgagtcactcagtgtcattatgatcacccgtgagtcacttggtgtcattatgaacatctgtgagtcactcagtgtcattatgatcacccgtgagtcactcggtgtcattatgatcacccgtgagtcactcggtgtcattatgatcacccgtgagtcactcggtgtcattatgatcacccgtgagtcactcggtgtcattatgatcacccgtgagtcactgagtttttatcacatggtgctattaccacctttgagtcactcggtgtcattatga

//