GGRNA ver.2 Home | Help | Advanced search    Previous release (v1)

2025-04-03 20:26:01, GGRNA.v2 : RefSeq release 228 (Jan, 2025)

LOCUS       XM_041698250            1101 bp    mRNA    linear   PLN 15-SEP-2021
DEFINITION  Aspergillus puulaauensis uncharacterized protein (APUU_12088S),
            partial mRNA.
ACCESSION   XM_041698250
VERSION     XM_041698250.1
DBLINK      BioProject: PRJNA728012
            BioSample: SAMD00269938
            Sequence Read Archive: DRR262021, DRR262022
KEYWORDS    RefSeq.
SOURCE      Aspergillus puulaauensis
  ORGANISM  Aspergillus puulaauensis
            Eukaryota; Fungi; Dikarya; Ascomycota; Pezizomycotina;
            Eurotiomycetes; Eurotiomycetidae; Eurotiales; Aspergillaceae;
            Aspergillus.
REFERENCE   1
  AUTHORS   Futagami,T., Mori,K., Kadooka,C. and Tanaka,T.
  TITLE     Aspergillus puulaauensis MK2 genome sequence
  JOURNAL   Unpublished
REFERENCE   2  (bases 1 to 1101)
  CONSRTM   NCBI Genome Project
  TITLE     Direct Submission
  JOURNAL   Submitted (15-SEP-2021) National Center for Biotechnology
            Information, NIH, Bethesda, MD 20894, USA
REFERENCE   3  (bases 1 to 1101)
  AUTHORS   Kazuki,M. and Futagami,T.
  CONSRTM   Aspergillus puulaauensis MK2 genome sequencing consortium
  TITLE     Direct Submission
  JOURNAL   Submitted (28-JAN-2021) Contact:Taiki Futagami Kagoshima
            University, Agriculture; Korimoto 1-21-24, Kagoshima, Kagoshima
            890-0065, Japan
COMMENT     PROVISIONAL REFSEQ: This record has not yet been subject to final
            NCBI review. This record is derived from an annotated genomic
            sequence (NC_054857).
            COMPLETENESS: incomplete on both ends.
FEATURES             Location/Qualifiers
     source          1..1101
                     /organism="Aspergillus puulaauensis"
                     /mol_type="mRNA"
                     /strain="MK2"
                     /db_xref="taxon:1220207"
                     /chromosome="1"
                     /geo_loc_name="Japan"
                     /collection_date="2019"
     gene            <1..>1101
                     /locus_tag="APUU_12088S"
                     /db_xref="GeneID:64969265"
     CDS             1..1101
                     /locus_tag="APUU_12088S"
                     /note="COG:O;
                     EggNog:ENOG410PGPE;
                     InterPro:IPR017937,IPR011679,IPR036249,IPR005788,
                     IPR013766,IPR036356;
                     PFAM:PF13098,PF00085,PF07749;
                     SECRETED:SignalP(1-18);
                     go_component: GO:0005783 - endoplasmic reticulum [Evidence
                     IEA];
                     go_function: GO:0003756 - protein disulfide isomerase
                     activity [Evidence IEA]"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_041551454.1"
                     /db_xref="GeneID:64969265"
                     /translation="
MARLSILLLSCLVTLATAGSAVLDLIPKNFDKVVLDSGKPALVEFFAPWCGHCKTLAPVYEELGQAFAHAEDKVSVAKVDADANRDLGKRFGIQGFPTLKWFDGKSETPVDYSGGRDLESLTAFITEKTGIKAKGPKKEPSNVEALTDTTFKSTIGGDKDVLVAFTAPWCGHCKKLAPTWETLATDFALEPSVVIGKIDAEAENAKATSKEQGVTGYPTIKFFPKGSTEGEIYQGGRSEEAFVEFLNKKAGTHRAPGGGLDEKAGTVPALDELVAKYTSSQNFNELVGEIKKAAKGVQDKYTEYYVKVAEKLSQNSEYAVKEFNRLKKVLSKGGSAPEKIDDLISRSNILRRFLGQEKEENVKDEL"
     misc_feature    61..375
                     /locus_tag="APUU_12088S"
                     /note="PDIa family, endoplasmic reticulum protein 38
                     (ERp38) subfamily; composed of proteins similar to the
                     P5-like protein first isolated from alfalfa, which
                     contains two redox active TRX (a) domains at the
                     N-terminus, like human P5, and a C-terminal domain...;
                     Region: PDI_a_ERp38; cd02998"
                     /db_xref="CDD:239296"
     misc_feature    order(148..150,157..159,346..348)
                     /locus_tag="APUU_12088S"
                     /note="catalytic residues [active]"
                     /db_xref="CDD:239296"
     misc_feature    424..738
                     /locus_tag="APUU_12088S"
                     /note="PDIa family, endoplasmic reticulum protein 38
                     (ERp38) subfamily; composed of proteins similar to the
                     P5-like protein first isolated from alfalfa, which
                     contains two redox active TRX (a) domains at the
                     N-terminus, like human P5, and a C-terminal domain...;
                     Region: PDI_a_ERp38; cd02998"
                     /db_xref="CDD:239296"
     misc_feature    order(508..510,517..519,709..711)
                     /locus_tag="APUU_12088S"
                     /note="catalytic residues [active]"
                     /db_xref="CDD:239296"
     misc_feature    793..1059
                     /locus_tag="APUU_12088S"
                     /note="Endoplasmic reticulum protein ERp29, C-terminal
                     domain; Region: ERp29; pfam07749"
                     /db_xref="CDD:462253"
ORIGIN      
atggctcgcctcagcatcctcctgctgagctgcctggtcactctggccaccgccggctccgccgtgctcgacctcatccccaagaacttcgacaaagtcgtcctggactccggcaagcccgcgctcgtcgaattcttcgcaccctggtgcggccactgcaagaccctcgcccccgtctatgaagagctcggccaagctttcgcccacgccgaagacaaagtcagcgttgcgaaggtcgacgctgacgcaaaccgcgacctcggcaagcgattcgggatccagggattcccgacgttgaaatggtttgatggcaagagcgagactcctgtggactacagtggtggtcgcgaccttgagagtctgactgctttcattactgagaagactggcattaaggctaaggggcctaagaaggagcctagcaatgtggaggcgttgactgatactacatttaagagcacaattggtggtgacaaggatgtgcttgttgcgtttactgcgccttggtgtggtcactgcaagaagctcgccccaacctgggaaaccctcgctactgacttcgctcttgaaccctccgttgttatcggcaagatcgacgccgaagccgaaaacgcaaaggccacttccaaggaacagggtgtgaccggataccccaccatcaagttcttccccaagggctcgaccgagggcgagatataccagggtggccgctccgaggaggccttcgttgagttcctgaacaagaaggcgggtacgcaccgtgcgcccggcggtggattggatgagaaggccggcaccgtccctgcgcttgatgagctagttgcgaagtacacctcttcgcagaacttcaacgagctggttggtgaaatcaagaaggctgccaagggcgttcaggacaagtacaccgagtactacgttaaagttgccgagaagctttcgcagaactccgagtatgcggttaaggagttcaaccgcctgaagaaggtgctgtccaagggtggttccgccccggagaagattgatgacctgatctcgcgcagcaacatcctgcgtagattcttgggtcaggagaaggaggagaacgtgaaggatgagctgtaa
//

by @meso_cacase at DBCLS
This page is licensed under a Creative Commons Attribution 4.0 International License (CC BY 4.0).

If you use GGRNA in your work, please cite:
Naito Y, Bono H. (2012)
GGRNA: an ultrafast, transcript-oriented search engine for genes and transcripts.
Nucleic Acids Res., 40, W592-W596. [Full Text]