2025-04-03 20:26:01, GGRNA.v2 : RefSeq release 228 (Jan, 2025)
LOCUS XM_041698250 1101 bp mRNA linear PLN 15-SEP-2021 DEFINITION Aspergillus puulaauensis uncharacterized protein (APUU_12088S), partial mRNA. ACCESSION XM_041698250 VERSION XM_041698250.1 DBLINK BioProject: PRJNA728012 BioSample: SAMD00269938 Sequence Read Archive: DRR262021, DRR262022 KEYWORDS RefSeq. SOURCE Aspergillus puulaauensis ORGANISM Aspergillus puulaauensis Eukaryota; Fungi; Dikarya; Ascomycota; Pezizomycotina; Eurotiomycetes; Eurotiomycetidae; Eurotiales; Aspergillaceae; Aspergillus. REFERENCE 1 AUTHORS Futagami,T., Mori,K., Kadooka,C. and Tanaka,T. TITLE Aspergillus puulaauensis MK2 genome sequence JOURNAL Unpublished REFERENCE 2 (bases 1 to 1101) CONSRTM NCBI Genome Project TITLE Direct Submission JOURNAL Submitted (15-SEP-2021) National Center for Biotechnology Information, NIH, Bethesda, MD 20894, USA REFERENCE 3 (bases 1 to 1101) AUTHORS Kazuki,M. and Futagami,T. CONSRTM Aspergillus puulaauensis MK2 genome sequencing consortium TITLE Direct Submission JOURNAL Submitted (28-JAN-2021) Contact:Taiki Futagami Kagoshima University, Agriculture; Korimoto 1-21-24, Kagoshima, Kagoshima 890-0065, Japan COMMENT PROVISIONAL REFSEQ: This record has not yet been subject to final NCBI review. This record is derived from an annotated genomic sequence (NC_054857). COMPLETENESS: incomplete on both ends. FEATURES Location/Qualifiers source 1..1101 /organism="Aspergillus puulaauensis" /mol_type="mRNA" /strain="MK2" /db_xref="taxon:1220207" /chromosome="1" /geo_loc_name="Japan" /collection_date="2019" gene <1..>1101 /locus_tag="APUU_12088S" /db_xref="GeneID:64969265" CDS 1..1101 /locus_tag="APUU_12088S" /note="COG:O; EggNog:ENOG410PGPE; InterPro:IPR017937,IPR011679,IPR036249,IPR005788, IPR013766,IPR036356; PFAM:PF13098,PF00085,PF07749; SECRETED:SignalP(1-18); go_component: GO:0005783 - endoplasmic reticulum [Evidence IEA]; go_function: GO:0003756 - protein disulfide isomerase activity [Evidence IEA]" /codon_start=1 /product="uncharacterized protein" /protein_id="XP_041551454.1" /db_xref="GeneID:64969265" /translation="
MARLSILLLSCLVTLATAGSAVLDLIPKNFDKVVLDSGKPALVEFFAPWCGHCKTLAPVYEELGQAFAHAEDKVSVAKVDADANRDLGKRFGIQGFPTLKWFDGKSETPVDYSGGRDLESLTAFITEKTGIKAKGPKKEPSNVEALTDTTFKSTIGGDKDVLVAFTAPWCGHCKKLAPTWETLATDFALEPSVVIGKIDAEAENAKATSKEQGVTGYPTIKFFPKGSTEGEIYQGGRSEEAFVEFLNKKAGTHRAPGGGLDEKAGTVPALDELVAKYTSSQNFNELVGEIKKAAKGVQDKYTEYYVKVAEKLSQNSEYAVKEFNRLKKVLSKGGSAPEKIDDLISRSNILRRFLGQEKEENVKDEL"
misc_feature 61..375 /locus_tag="APUU_12088S" /note="PDIa family, endoplasmic reticulum protein 38 (ERp38) subfamily; composed of proteins similar to the P5-like protein first isolated from alfalfa, which contains two redox active TRX (a) domains at the N-terminus, like human P5, and a C-terminal domain...; Region: PDI_a_ERp38; cd02998" /db_xref="CDD:239296" misc_feature order(148..150,157..159,346..348) /locus_tag="APUU_12088S" /note="catalytic residues [active]" /db_xref="CDD:239296" misc_feature 424..738 /locus_tag="APUU_12088S" /note="PDIa family, endoplasmic reticulum protein 38 (ERp38) subfamily; composed of proteins similar to the P5-like protein first isolated from alfalfa, which contains two redox active TRX (a) domains at the N-terminus, like human P5, and a C-terminal domain...; Region: PDI_a_ERp38; cd02998" /db_xref="CDD:239296" misc_feature order(508..510,517..519,709..711) /locus_tag="APUU_12088S" /note="catalytic residues [active]" /db_xref="CDD:239296" misc_feature 793..1059 /locus_tag="APUU_12088S" /note="Endoplasmic reticulum protein ERp29, C-terminal domain; Region: ERp29; pfam07749" /db_xref="CDD:462253" ORIGIN
atggctcgcctcagcatcctcctgctgagctgcctggtcactctggccaccgccggctccgccgtgctcgacctcatccccaagaacttcgacaaagtcgtcctggactccggcaagcccgcgctcgtcgaattcttcgcaccctggtgcggccactgcaagaccctcgcccccgtctatgaagagctcggccaagctttcgcccacgccgaagacaaagtcagcgttgcgaaggtcgacgctgacgcaaaccgcgacctcggcaagcgattcgggatccagggattcccgacgttgaaatggtttgatggcaagagcgagactcctgtggactacagtggtggtcgcgaccttgagagtctgactgctttcattactgagaagactggcattaaggctaaggggcctaagaaggagcctagcaatgtggaggcgttgactgatactacatttaagagcacaattggtggtgacaaggatgtgcttgttgcgtttactgcgccttggtgtggtcactgcaagaagctcgccccaacctgggaaaccctcgctactgacttcgctcttgaaccctccgttgttatcggcaagatcgacgccgaagccgaaaacgcaaaggccacttccaaggaacagggtgtgaccggataccccaccatcaagttcttccccaagggctcgaccgagggcgagatataccagggtggccgctccgaggaggccttcgttgagttcctgaacaagaaggcgggtacgcaccgtgcgcccggcggtggattggatgagaaggccggcaccgtccctgcgcttgatgagctagttgcgaagtacacctcttcgcagaacttcaacgagctggttggtgaaatcaagaaggctgccaagggcgttcaggacaagtacaccgagtactacgttaaagttgccgagaagctttcgcagaactccgagtatgcggttaaggagttcaaccgcctgaagaaggtgctgtccaagggtggttccgccccggagaagattgatgacctgatctcgcgcagcaacatcctgcgtagattcttgggtcaggagaaggaggagaacgtgaaggatgagctgtaa
//
by
@meso_cacase at
DBCLS
This page is licensed under a
Creative Commons Attribution 4.0 International License (CC BY 4.0).
If you use GGRNA in your work, please cite:
Naito Y, Bono H. (2012)
GGRNA: an ultrafast, transcript-oriented search engine for genes and transcripts.
Nucleic Acids Res., 40, W592-W596.
[Full Text]