2025-10-16 18:19:17, GGRNA.v2 : RefSeq release 232 (Sep, 2025)
LOCUS XM_041684881 240 bp mRNA linear PLN 22-FEB-2025 DEFINITION Aspergillus luchuensis uncharacterized protein (AKAW2_20194A), partial mRNA. ACCESSION XM_041684881 VERSION XM_041684881.1 DBLINK BioProject: PRJNA727292 BioSample: SAMD00269936 Sequence Read Archive: DRR262015, DRR262016, DRR262017 KEYWORDS RefSeq. SOURCE Aspergillus luchuensis ORGANISM Aspergillus luchuensis Eukaryota; Fungi; Dikarya; Ascomycota; Pezizomycotina; Eurotiomycetes; Eurotiomycetidae; Eurotiales; Aspergillaceae; Aspergillus; Aspergillus subgen. Circumdati. REFERENCE 1 AUTHORS Mori,K., Kadooka,C., Goto,M. and Futagami,T. TITLE Aspergillus luchuensis mut. kawachii IFO 4304 genome sequence JOURNAL Unpublished REFERENCE 2 (bases 1 to 240) CONSRTM NCBI Genome Project TITLE Direct Submission JOURNAL Submitted (22-FEB-2025) National Center for Biotechnology Information, NIH, Bethesda, MD 20894, USA REFERENCE 3 (bases 1 to 240) AUTHORS Kazuki,M. and Futagami,T. CONSRTM Aspergillus luchuensis mut. kawachii IFO 4304 genome sequencing consortium TITLE Direct Submission JOURNAL Submitted (28-JAN-2021) Contact:Taiki Futagami Kagoshima University, Agriculture; Korimoto 1-21-24, Kagoshima, Kagoshima 890-0065, Japan COMMENT PROVISIONAL REFSEQ: This record has not yet been subject to final NCBI review. This record is derived from an annotated genomic sequence (NC_054850). COMPLETENESS: incomplete on both ends. FEATURES Location/Qualifiers source 1..240 /organism="Aspergillus luchuensis" /mol_type="mRNA" /strain="IFO 4308" /db_xref="taxon:1069201" /chromosome="2" /geo_loc_name="Japan" gene <1..>240 /locus_tag="AKAW2_20194A" /db_xref="GeneID:64956579" CDS 1..240 /locus_tag="AKAW2_20194A" /note="COG:S; EggNog:ENOG410PTK3; InterPro:IPR010580; PFAM:PF06624; TransMembrane:1 (i42-63o); go_component: GO:0005783 - endoplasmic reticulum [Evidence IEA]" /codon_start=1 /product="uncharacterized protein" /protein_id="XP_041539020.1" /db_xref="GeneID:64956579" /translation="
MAQTPQQRKANERFAKQESAKRGKGKTVVKSKQTPRSPVSTVWVAILAFVVCGGIFLEVLGIVPKLWSTVVASVSRLIL"
misc_feature 4..180 /locus_tag="AKAW2_20194A" /note="Ribosome associated membrane protein RAMP4; Region: RAMP4; pfam06624" /db_xref="CDD:461965" ORIGIN
atggctcaaactccccagcaaaggaaggccaacgaaaggttcgcgaagcaggaatctgcaaagcgtggtaaaggcaagacagttgtcaagtcaaagcagactccaaggtcgcctgtgtccactgtgtgggtggccattctcgcgttcgttgtctgtggaggaatcttccttgaagttctagggatcgtaccgaagctttggtccaccgtggtcgcaagcgtcagccgcttaatactttga
//
by
@meso_cacase at
DBCLS
This page is licensed under a
Creative Commons Attribution 4.0 International License (CC BY 4.0).
If you use GGRNA in your work, please cite:
Naito Y, Bono H. (2012)
GGRNA: an ultrafast, transcript-oriented search engine for genes and transcripts.
Nucleic Acids Res., 40, W592-W596.
[Full Text]