ver.2
Home
|
Help
|
Advanced search
Previous release (v1)
2026-10-05 17:50:19, GGRNA.v2 : RefSeq release 233 (Jan, 2026)
LOCUS XM_041340048 372 bp mRNA linear PLN 15-SEP-2021
DEFINITION Suillus subaureus uncharacterized protein (BJ212DRAFT_1480241),
partial mRNA.
ACCESSION XM_041340048
VERSION XM_041340048.1
DBLINK BioProject: PRJNA727286
BioSample: SAMN05920861
KEYWORDS RefSeq.
SOURCE Suillus subaureus
ORGANISM Suillus subaureus
Eukaryota; Fungi; Dikarya; Basidiomycota; Agaricomycotina;
Agaricomycetes; Agaricomycetidae; Boletales; Suillineae;
Suillaceae; Suillus.
REFERENCE 1 (bases 1 to 372)
AUTHORS Lofgren,L.A., Nguyen,N.H., Vilgalys,R., Ruytinx,J., Liao,H.L.,
Branco,S., Kuo,A., LaButti,K., Lipzen,A., Andreopoulos,W.,
Pangilinan,J., Riley,R., Hundley,H., Na,H., Barry,K.,
Grigoriev,I.V., Stajich,J.E. and Kennedy,P.G.
TITLE Comparative genomics reveals dynamic genome evolution in host
specialist ectomycorrhizal fungi
JOURNAL New Phytol (2020) In press
PUBMED 33355923
REMARK Publication Status: Available-Online prior to print
REFERENCE 2 (bases 1 to 372)
CONSRTM NCBI Genome Project
TITLE Direct Submission
JOURNAL Submitted (15-SEP-2021) National Center for Biotechnology
Information, NIH, Bethesda, MD 20894, USA
REFERENCE 3 (bases 1 to 372)
AUTHORS Kuo,A., Lofgren,L.A., Vilgalys,R., Nguyen,N.H., Ruytinx,J.,
Liao,H.-L., Branco,S., LaButti,K., Lipzen,A., Andreopoulos,W.,
Pangilinan,J., Riley,R., Hundley,H., Na,H., Grigoriev,I., Barry,K.,
Stajich,J.E. and Kennedy,P.G.
CONSRTM DOE Joint Genome Institute
TITLE Direct Submission
JOURNAL Submitted (23-APR-2020) DOE Joint Genome Institute, 2800 Mitchell
Drive, Walnut Creek, CA 94598-1698, USA
COMMENT PROVISIONAL REFSEQ: This record has not yet been subject to final
NCBI review. This record is derived from an annotated genomic
sequence (NW_024538569).
##Metadata-START##
Organism Display Name :: Suillus subaureus MN1 v1.0
GOLD Stamp ID :: Gp0114556
##Metadata-END##
COMPLETENESS: incomplete on both ends.
FEATURES Location/Qualifiers
source 1..372
/organism="Suillus subaureus"
/mol_type="mRNA"
/strain="MN1"
/db_xref="taxon:48587"
/chromosome="Unknown"
gene <1..>372
/locus_tag="BJ212DRAFT_1480241"
/db_xref="GeneID:64634064"
CDS 1..372
/locus_tag="BJ212DRAFT_1480241"
/codon_start=1
/product="uncharacterized protein"
/protein_id="XP_041193930.1"
/db_xref="GeneID:64634064"
/db_xref="JGIDB:Suisub1_1480241"
/translation="
MLDIIDTGTTASSSVDWCTTWKNPPEAAALQEEIENIHSEGCVCLVLQAQHPTKFMTSWSHQAYWRNPTYLMVKFALCIIGGLFVEFTFYCTSDLLQGTQNKLFAIFLASALSVPLSQQLQVM"
misc_feature <1..363
/locus_tag="BJ212DRAFT_1480241"
/note="Pleiotropic Drug Resistance (PDR) Family protein;
Region: 3a01205; TIGR00956"
/db_xref="CDD:273362"
ORIGIN
atgctcgacatcattgacacaggcacaacggcatcgtcctcggttgactggtgcaccacctggaagaatccacctgaggctgctgcactccaagaagagattgagaatatccatagtgaaggctgcgtttgcctggtcttacaggcacaacaccccaccaagttcatgacttcatggagtcaccaggcctactggcgcaatccgacctatctcatggttaagtttgcgctttgcatcattggcggcttgtttgttgaattcacgttctactgcactagtgatttgctccagggtacccagaacaagctctttgcgatcttcttggcctcagcactgtctgtccccctttcacagcagcttcaggtaatgtag
//
by
@meso_cacase at
DBCLS
This page is licensed under a
Creative Commons Attribution 4.0 International License (CC BY 4.0).
If you use GGRNA in your work, please cite:
Naito Y, Bono H. (2012)
GGRNA: an ultrafast, transcript-oriented search engine for genes and transcripts.
Nucleic Acids Res., 40, W592-W596.
[Full Text]