GGRNA ver.2 Home | Help | Advanced search    Previous release (v1)

2026-10-05 17:50:19, GGRNA.v2 : RefSeq release 233 (Jan, 2026)

LOCUS       XM_041340048             372 bp    mRNA    linear   PLN 15-SEP-2021
DEFINITION  Suillus subaureus uncharacterized protein (BJ212DRAFT_1480241),
            partial mRNA.
ACCESSION   XM_041340048
VERSION     XM_041340048.1
DBLINK      BioProject: PRJNA727286
            BioSample: SAMN05920861
KEYWORDS    RefSeq.
SOURCE      Suillus subaureus
  ORGANISM  Suillus subaureus
            Eukaryota; Fungi; Dikarya; Basidiomycota; Agaricomycotina;
            Agaricomycetes; Agaricomycetidae; Boletales; Suillineae;
            Suillaceae; Suillus.
REFERENCE   1  (bases 1 to 372)
  AUTHORS   Lofgren,L.A., Nguyen,N.H., Vilgalys,R., Ruytinx,J., Liao,H.L.,
            Branco,S., Kuo,A., LaButti,K., Lipzen,A., Andreopoulos,W.,
            Pangilinan,J., Riley,R., Hundley,H., Na,H., Barry,K.,
            Grigoriev,I.V., Stajich,J.E. and Kennedy,P.G.
  TITLE     Comparative genomics reveals dynamic genome evolution in host
            specialist ectomycorrhizal fungi
  JOURNAL   New Phytol (2020) In press
   PUBMED   33355923
  REMARK    Publication Status: Available-Online prior to print
REFERENCE   2  (bases 1 to 372)
  CONSRTM   NCBI Genome Project
  TITLE     Direct Submission
  JOURNAL   Submitted (15-SEP-2021) National Center for Biotechnology
            Information, NIH, Bethesda, MD 20894, USA
REFERENCE   3  (bases 1 to 372)
  AUTHORS   Kuo,A., Lofgren,L.A., Vilgalys,R., Nguyen,N.H., Ruytinx,J.,
            Liao,H.-L., Branco,S., LaButti,K., Lipzen,A., Andreopoulos,W.,
            Pangilinan,J., Riley,R., Hundley,H., Na,H., Grigoriev,I., Barry,K.,
            Stajich,J.E. and Kennedy,P.G.
  CONSRTM   DOE Joint Genome Institute
  TITLE     Direct Submission
  JOURNAL   Submitted (23-APR-2020) DOE Joint Genome Institute, 2800 Mitchell
            Drive, Walnut Creek, CA 94598-1698, USA
COMMENT     PROVISIONAL REFSEQ: This record has not yet been subject to final
            NCBI review. This record is derived from an annotated genomic
            sequence (NW_024538569).
            
            ##Metadata-START##
            Organism Display Name :: Suillus subaureus MN1 v1.0
            GOLD Stamp ID         :: Gp0114556
            ##Metadata-END##
            COMPLETENESS: incomplete on both ends.
FEATURES             Location/Qualifiers
     source          1..372
                     /organism="Suillus subaureus"
                     /mol_type="mRNA"
                     /strain="MN1"
                     /db_xref="taxon:48587"
                     /chromosome="Unknown"
     gene            <1..>372
                     /locus_tag="BJ212DRAFT_1480241"
                     /db_xref="GeneID:64634064"
     CDS             1..372
                     /locus_tag="BJ212DRAFT_1480241"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_041193930.1"
                     /db_xref="GeneID:64634064"
                     /db_xref="JGIDB:Suisub1_1480241"
                     /translation="
MLDIIDTGTTASSSVDWCTTWKNPPEAAALQEEIENIHSEGCVCLVLQAQHPTKFMTSWSHQAYWRNPTYLMVKFALCIIGGLFVEFTFYCTSDLLQGTQNKLFAIFLASALSVPLSQQLQVM"
     misc_feature    <1..363
                     /locus_tag="BJ212DRAFT_1480241"
                     /note="Pleiotropic Drug Resistance (PDR) Family protein;
                     Region: 3a01205; TIGR00956"
                     /db_xref="CDD:273362"
ORIGIN      
atgctcgacatcattgacacaggcacaacggcatcgtcctcggttgactggtgcaccacctggaagaatccacctgaggctgctgcactccaagaagagattgagaatatccatagtgaaggctgcgtttgcctggtcttacaggcacaacaccccaccaagttcatgacttcatggagtcaccaggcctactggcgcaatccgacctatctcatggttaagtttgcgctttgcatcattggcggcttgtttgttgaattcacgttctactgcactagtgatttgctccagggtacccagaacaagctctttgcgatcttcttggcctcagcactgtctgtccccctttcacagcagcttcaggtaatgtag
//

by @meso_cacase at DBCLS
This page is licensed under a Creative Commons Attribution 4.0 International License (CC BY 4.0).

If you use GGRNA in your work, please cite:
Naito Y, Bono H. (2012)
GGRNA: an ultrafast, transcript-oriented search engine for genes and transcripts.
Nucleic Acids Res., 40, W592-W596. [Full Text]