GGRNA ver.2 Home | Help | Advanced search    Previous release (v1)

2025-04-03 19:46:58, GGRNA.v2 : RefSeq release 228 (Jan, 2025)

LOCUS       XM_038101673             435 bp    mRNA    linear   INV 10-DEC-2020
DEFINITION  PREDICTED: Teleopsis dalmanni uncharacterized protein
            PF11_0213-like (LOC119687384), mRNA.
ACCESSION   XM_038101673
VERSION     XM_038101673.1
DBLINK      BioProject: PRJNA682940
KEYWORDS    RefSeq; includes ab initio.
SOURCE      Teleopsis dalmanni (Cyrtodiopsis dalmanii)
  ORGANISM  Teleopsis dalmanni
            Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta;
            Pterygota; Neoptera; Endopterygota; Diptera; Brachycera;
            Muscomorpha; Diopsoidea; Diopsidae; Teleopsis.
COMMENT     MODEL REFSEQ:  This record is predicted by automated computational
            analysis. This record is derived from a genomic sequence
            (NC_051848.1) annotated using gene prediction method: Gnomon.
            Also see:
                Documentation of NCBI's Annotation Process
            
            ##Genome-Annotation-Data-START##
            Annotation Provider         :: NCBI
            Annotation Status           :: Full annotation
            Annotation Name             :: Teleopsis dalmanni Annotation
                                           Release 100
            Annotation Version          :: 100
            Annotation Pipeline         :: NCBI eukaryotic genome annotation
                                           pipeline
            Annotation Software Version :: 8.5
            Annotation Method           :: Best-placed RefSeq; Gnomon
            Features Annotated          :: Gene; mRNA; CDS; ncRNA
            ##Genome-Annotation-Data-END##
            
            ##RefSeq-Attributes-START##
            ab initio :: 100% of CDS bases
            ##RefSeq-Attributes-END##
FEATURES             Location/Qualifiers
     source          1..435
                     /organism="Teleopsis dalmanni"
                     /mol_type="mRNA"
                     /isolate="2A"
                     /isolation_source="laboratory"
                     /db_xref="taxon:139649"
                     /chromosome="X"
                     /sex="female"
                     /geo_loc_name="USA: Maryland"
                     /lat_lon="38.99 N 76.94 W"
                     /collection_date="Sep-2011/Oct-2014"
     gene            1..435
                     /gene="LOC119687384"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Gnomon. Supporting evidence
                     includes similarity to: 1 Protein"
                     /db_xref="GeneID:119687384"
     CDS             1..435
                     /gene="LOC119687384"
                     /codon_start=1
                     /product="uncharacterized protein PF11_0213-like"
                     /protein_id="XP_037957601.1"
                     /db_xref="GeneID:119687384"
                     /translation="
MYIRTSRFHDSREDHNDLEHLENLKDFEGLEDYEDYENHEYLEYFEVLEFLEDRGNLEVPKYHKNLEDLEKVEDLKHHEDFKNVNELKNLEKIEKYEDLEELEDINGLKYREDLEHLEDLKDVKVPKYHKDLEYIEDLEVDSLT"
ORIGIN      
atgtacatacgtacgtctcgattccatgacagtcgtgaagaccataacgaccttgaacatctcgagaacctcaaagattttgaaggccttgaagactatgaagactatgaaaaccatgaatatctcgaatactttgaagttcttgaattccttgaagaccgtggaaaccttgaagtccctaaataccataaaaaccttgaagaccttgaaaaagttgaagatcttaaacaccatgaagattttaaaaacgttaatgaacttaaaaaccttgaaaaaattgaaaaatatgaagatcttgaagagcttgaagacattaatggccttaaatatcgtgaagaccttgaacacctcgaagaccttaaagatgttaaagtccctaaataccataaagaccttgaatatatcgaagatcttgaagtagatagtctcacttga
//

by @meso_cacase at DBCLS
This page is licensed under a Creative Commons Attribution 4.0 International License (CC BY 4.0).

If you use GGRNA in your work, please cite:
Naito Y, Bono H. (2012)
GGRNA: an ultrafast, transcript-oriented search engine for genes and transcripts.
Nucleic Acids Res., 40, W592-W596. [Full Text]