ver.2
Home
|
Help
|
Advanced search
Previous release (v1)
2026-10-05 18:49:41, GGRNA.v2 : RefSeq release 233 (Jan, 2026)
LOCUS XM_035982506 1546 bp mRNA linear PLN 01-SEP-2020 DEFINITION PREDICTED: Helianthus annuus protein argonaute 1A (LOC110901336), transcript variant X2, mRNA. ACCESSION XM_035982506 VERSION XM_035982506.1 DBLINK BioProject: PRJNA396063 KEYWORDS RefSeq. SOURCE Helianthus annuus (common sunflower) ORGANISM Helianthus annuus Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta; Spermatophyta; Magnoliopsida; eudicotyledons; Gunneridae; Pentapetalae; asterids; campanulids; Asterales; Asteraceae; Asteroideae; Heliantheae alliance; Heliantheae; Helianthus. COMMENT MODEL REFSEQ: This record is predicted by automated computational analysis. This record is derived from a genomic sequence (NC_035445.2) annotated using gene prediction method: Gnomon. Also see: Documentation of NCBI's Annotation Process ##Genome-Annotation-Data-START## Annotation Provider :: NCBI Annotation Status :: Full annotation Annotation Name :: Helianthus annuus Annotation Release 101 Annotation Version :: 101 Annotation Pipeline :: NCBI eukaryotic genome annotation pipeline Annotation Software Version :: 8.5 Annotation Method :: Best-placed RefSeq; Gnomon Features Annotated :: Gene; mRNA; CDS; ncRNA ##Genome-Annotation-Data-END## FEATURES Location/Qualifiers source 1..1546 /organism="Helianthus annuus" /mol_type="mRNA" /cultivar="XRQ/B" /specimen_voucher="SF193" /db_xref="taxon:4232" /chromosome="13" /tissue_type="leaves" /dev_stage="4 leaves" /geo_loc_name="France" /collected_by="INRA, LIPM" gene 1..1546 /gene="LOC110901336" /note="Derived by automated computational analysis using gene prediction method: Gnomon. Supporting evidence includes similarity to: 100% coverage of the annotated genomic feature by RNAseq alignments, including 2 samples with support for all annotated introns" /db_xref="GeneID:110901336" CDS 869..1531 /gene="LOC110901336" /codon_start=1 /product="protein argonaute 1A isoform X1" /protein_id="XP_035838399.1" /db_xref="GeneID:110901336" /translation="
MVVCIVKHDMEIIHLFTDASSSTIWRSSTFSPMLIPSKSFLTLSLTDMAATAFVEAVHVIDFVKQLLNRNDTTRPLSDADRIKKALKGVKVEITHRGTMRRRFNISGLTSQATRELQFTVGGDGDTVTKYVVDYFKDAYGFSIQHVHWPCLQLGGTHRKNYMPMEVCKIVAGQRYSRKLNERQVTALLKVTCQRPQDREHGILKVMLSNLPMNHHVMCKS"
misc_feature 1043..1378
/gene="LOC110901336"
/note="PAZ domain, argonaute_like subfamily. Argonaute is
part of the RNA-induced silencing complex (RISC), and is
an endonuclease that plays a key role in the RNA
interference pathway. The PAZ domain has been named after
the proteins Piwi,Argonaut, and Zwille; Region:
PAZ_argonaute_like; cd02846"
/db_xref="CDD:239212"
misc_feature order(1175..1177,1220..1222,1259..1261,1271..1273,
1325..1327,1346..1348,1352..1354)
/gene="LOC110901336"
/note="nucleic acid-binding interface [nucleotide
binding]; other site"
/db_xref="CDD:239212"
ORIGIN
ttctcatctttgttttgaaacgcctagggttccttctctctctatattcaggcgattcaaacttcacaaaccctaaccccctttaacaatcaccaccaccgagaatcgccctatatctggatactaacaccaacaatcagagcataataaacctgcaactttagcagcatcttcttcgtcgagaaatgatctggatcagatgcgtctttgctcgaatcttggtgtgaccaatcagatggttaaagcttcccaagaatccattcaaaatactaaagagtttgatatatggtctgggttattagcaaaggtgccctgatctagcaaagccggatttgtatttttagaattttaaggtgcctggcttaggtgattccagttgatggtagcgattgttggtgacggagatgaacttcggctgccagaccacaaccacatgggtttctgatggtgttcgatttcatcaaagtttatgtgataaaaaatgagtatgtgctacgttgacctgctcaagaagaatgaagattgctttgggcacgattcagatgtgtatgcatctccgctatatgcatggtggcgctaccaaaaagtgctgctgcaggtcctttggaaatccacatcgctgcaagttcactggataatccaccatcggacctgtatcttgggtcttttcatgctggtgacgatgttggctccccaaaggggtacctcggatcagctgctctttagaagactacagaagctgatgttgctgggtctctgttctgtccattctgcttctagggggtactcatgagaactggatgcatcagtactggatggttgttcgcatcgtcaagcatgctatggagaaacaaccgtaaaaaggttgatggttgtttgcatcgtcaagcacgatatggagatcatccaccttttcaccgatgcatcgtcaagcacgatatggagatcatccaccttttcaccgatgctaatcccatccaaatcattcttgacgctgtcattaacagatatggctgcaactgcattcgttgaggcagtgcatgtgatagactttgtcaaacaacttctgaataggaatgacacaacaagacctttatctgatgctgaccggataaaaaaagcacttaaaggagtgaaggttgaaataactcaccgtggaactatgcgccggaggtttaacatatccggtttaacatctcaagcaacacgcgagctacagttcacggttggtggtgacggagatacggtgacgaaatatgtggttgattacttcaaggatgcttacgggttttccatccagcatgtacattggccgtgcttgcaacttggcgggacccataggaaaaattatatgcctatggaggtctgcaagattgtagcgggccagaggtattcaaggaagctaaatgagcgacaagttaccgcccttcttaaggtcacgtgtcaacgccctcaggatcgagagcacggtattctcaaggtaatgttatctaatttaccgatgaaccatcatgtcatgtgtaaaagttaacatatgtcttgtatc
//
by
@meso_cacase at
DBCLS
This page is licensed under a
Creative Commons Attribution 4.0 International License (CC BY 4.0).
If you use GGRNA in your work, please cite:
Naito Y, Bono H. (2012)
GGRNA: an ultrafast, transcript-oriented search engine for genes and transcripts.
Nucleic Acids Res., 40, W592-W596.
[Full Text]