ver.2
Home
|
Help
|
Advanced search
Previous release (v1)
2025-12-08 04:08:14, GGRNA.v2 : RefSeq release 232 (Sep, 2025)
LOCUS XM_031420155 852 bp mRNA linear PLN 22-OCT-2019
DEFINITION PREDICTED: Pistacia vera CST complex subunit TEN1-like
(LOC116134465), transcript variant X9, mRNA.
ACCESSION XM_031420155
VERSION XM_031420155.1
DBLINK BioProject: PRJNA578116
KEYWORDS RefSeq.
SOURCE Pistacia vera
ORGANISM Pistacia vera
Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta;
Spermatophyta; Magnoliopsida; eudicotyledons; Gunneridae;
Pentapetalae; rosids; malvids; Sapindales; Anacardiaceae; Pistacia.
COMMENT MODEL REFSEQ: This record is predicted by automated computational
analysis. This record is derived from a genomic sequence
(NW_022196100.1) annotated using gene prediction method: Gnomon.
Also see:
Documentation of NCBI's Annotation Process
##Genome-Annotation-Data-START##
Annotation Provider :: NCBI
Annotation Status :: Full annotation
Annotation Name :: Pistacia vera Annotation Release 100
Annotation Version :: 100
Annotation Pipeline :: NCBI eukaryotic genome annotation
pipeline
Annotation Software Version :: 8.2
Annotation Method :: Best-placed RefSeq; Gnomon
Features Annotated :: Gene; mRNA; CDS; ncRNA
##Genome-Annotation-Data-END##
FEATURES Location/Qualifiers
source 1..852
/organism="Pistacia vera"
/mol_type="mRNA"
/cultivar="Batoury"
/db_xref="taxon:55513"
/chromosome="Unknown"
/tissue_type="leaf"
/geo_loc_name="China"
gene 1..852
/gene="LOC116134465"
/note="Derived by automated computational analysis using
gene prediction method: Gnomon. Supporting evidence
includes similarity to: 4 Proteins, and 100% coverage of
the annotated genomic feature by RNAseq alignments,
including 5 samples with support for all annotated
introns"
/db_xref="GeneID:116134465"
CDS 209..589
/gene="LOC116134465"
/codon_start=1
/product="CST complex subunit TEN1-like isoform X3"
/protein_id="XP_031276015.1"
/db_xref="GeneID:116134465"
/translation="
MASSAIKSGALVTLPELNPSSQFFEEGASLRVTGKLQEYSVETAIAIIADGSAILKIDTQHLRDLSFRVGSIYQFIGELHIQLDNEAILQARVGRNVDGLDLNLYHQSLQLLRQFQAERYNNLMQL"
misc_feature 224..565
/gene="LOC116134465"
/note="Telomere-capping, CST complex subunit; Region:
Ten1_2; pfam15490"
/db_xref="CDD:464745"
ORIGIN
tttaaattttggtggttgattttgtttcgatttttcttccaaaaattttgcttttataactgtcgtttaagttattttatatcacaagaagagattgtgatctttgactttaatggggttcttgttgccgttatgaagttttcaggttagtttgttgtgtgtggagtgtagcttgctggcgctttttgagtgagttggtggcagtttgatggcatcctcggcaataaaatctggggcattggttactttaccagagttaaacccatcatctcaattctttgaagaaggagcttcgctaagagttactgggaagttacaagagtattccgtggagacagccatagccataattgctgatggaagtgccatcttaaagatcgacacccagcacctgagggaccttagttttcgagttgggtccatctatcagtttattggtgaactccatattcagcttgacaatgaggcaatcttgcaggcacgagtaggtaggaatgttgatggccttgacctgaacctgtatcatcagtcattgcagctactgagacagtttcaagctgagcggtacaacaacttaatgcagttataaaattaaacaggctcactcagagggaaaggtaccaaagtaacttcgtacctacatgtagacgtgttgaaaatggatgatttttttttccttttttaattctttcagtatttaactgttggatctctactacgaatacttaattcatcgttgatatctattaaatgtccatcaaaatatacgctgttataatttctgatttcctctggagcatagaaactgggtaatctgttcatttatgacagattcccacctttaagattgaa
//
by
@meso_cacase at
DBCLS
This page is licensed under a
Creative Commons Attribution 4.0 International License (CC BY 4.0).
If you use GGRNA in your work, please cite:
Naito Y, Bono H. (2012)
GGRNA: an ultrafast, transcript-oriented search engine for genes and transcripts.
Nucleic Acids Res., 40, W592-W596.
[Full Text]