LOCUS       XM_030796211            2337 bp    mRNA    linear   PRI 17-SEP-2019
DEFINITION  PREDICTED: Nomascus leucogenys retina and anterior neural fold
            homeobox 2 (RAX2), transcript variant X1, mRNA.
ACCESSION   XM_030796211
VERSION     XM_030796211.1
DBLINK      BioProject: PRJNA564096
KEYWORDS    RefSeq.
SOURCE      Nomascus leucogenys (northern white-cheeked gibbon)
  ORGANISM  Nomascus leucogenys
            Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
            Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini;
            Catarrhini; Hylobatidae; Nomascus.
COMMENT     MODEL REFSEQ:  This record is predicted by automated computational
            analysis. This record is derived from a genomic sequence
            (NC_044397.1) annotated using gene prediction method: Gnomon,
            supported by mRNA and EST evidence.
            Also see:
                Documentation of NCBI's Annotation Process
            
            ##Genome-Annotation-Data-START##
            Annotation Provider         :: NCBI
            Annotation Status           :: Full annotation
            Annotation Name             :: Nomascus leucogenys Annotation
                                           Release 103
            Annotation Version          :: 103
            Annotation Pipeline         :: NCBI eukaryotic genome annotation
                                           pipeline
            Annotation Software Version :: 8.2
            Annotation Method           :: Best-placed RefSeq; Gnomon
            Features Annotated          :: Gene; mRNA; CDS; ncRNA
            ##Genome-Annotation-Data-END##
FEATURES             Location/Qualifiers
     source          1..2337
                     /organism="Nomascus leucogenys"
                     /mol_type="mRNA"
                     /isolate="Asia"
                     /bio_material="CORIELL:NLL605"
                     /db_xref="taxon:61853"
                     /chromosome="17"
                     /sex="female"
                     /tissue_type="EB transformed lymphoblast cell line"
                     /dev_stage="adult"
     gene            1..2337
                     /gene="RAX2"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Gnomon. Supporting evidence
                     includes similarity to: 1 mRNA, 20 ESTs, 7 Proteins, and
                     86% coverage of the annotated genomic feature by RNAseq
                     alignments, including 4 samples with support for all
                     annotated introns"
                     /db_xref="GeneID:100588120"
     CDS             131..823
                     /gene="RAX2"
                     /codon_start=1
                     /product="retina and anterior neural fold homeobox protein
                     2 isoform X1"
                     /protein_id="XP_030652071.1"
                     /db_xref="GeneID:100588120"
                     /translation="

MPAPVEGTDFPGAGRQAWGSPALSLLVAPPAVSPPSVPLPSRQVGAMFLSPGEGPAAEGGGLGPGEEAPKKKHRRNRTTFTTYQLHQLERAFEASHYPDVYSREELAAKVHLPEVRVQVWFQNRRAKWRRQERLESGSGAMAAPRLPEAPALPFARPPAMSLPLEPWLGPGPPAVPGLPRLLGPGPGLQASFGPHAFGPTFADGFALEEASLRLLAKEHAQALDRAWPPA"

     misc_feature    350..520
                     /gene="RAX2"
                     /note="Region: Homeodomain; pfam00046"
                     /db_xref="CDD:459649"
ORIGIN      

gccgtgacagccacagagaggggaagagaaaacagggaaggtgacacacacagagagaaggaagagcagacagaggcacagcaggagacccccccaagcccgaggaggacagcccggggatgcagagcacatgccggccccagtggagggaacagatttccccggagccgggaggcaagcctggggctcccctgccctgtccctgctggtagccccgccggccgtctccccgccatctgtcccgctgccatcccgccaggtgggagccatgttcctgagcccgggcgaggggccggcagccgagggtgggggtctggggcccggcgaggaggcccccaagaagaagcaccggaggaaccgcaccaccttcaccacctaccagctgcaccagctggagcgggcgttcgaggcctctcactacccggatgtgtacagccgtgaggagctggcggccaaggtgcacctacccgaggtgcgcgtgcaggtgtggttccagaaccgccgggccaagtggcgccgccaggagcggctggagtcaggctcgggtgccatggcagctccgagactacccgaggccccagcactgccgttcgctcgccccccggccatgtcgctgcccctggagccctggttgggccccggaccgccggccgtcccaggcctcccccgcctcctgggcccgggcccagggctgcaagcgtccttcgggcctcatgcctttggtcccaccttcgcagatggcttcgccctggaagaggcgtccctgcggctgctggccaaggaacacgcacaggctctggacagggcctggccgccggcctgagcctgctgccctcccgggccccctcctccgcccgacccgagaaccggggatgtgccctggtgacagccaccacgccttggcctaggtgaaggtcatggagcaaccgtggtcaggccaggccaccaccactggggagcaggaccagagagacaggctgctgggtcccctgcccccatcccatcccccaccccatcgccacccgtcctgctggcagcagaccggcccccagtgtcaggcaggaggtgacccaagcatttctcaggctaggggcggggccctcctcccctcctggggcttcagtctcccgtctatgaattgagcatgggggactctgaggttcacaggctgcgaggctgtgggtgcctgcagggccgctgactctgtaagatgagtgtaaatctctctgctgatcctaatccccatcagcagagctgcccactctgcaggctcccagtcccctggaaataacaaatagcggcagctcccgcaagcctggtctcctctcaccatgtgcccgccatgtgagcgctcccctctccattacgccctggacctcgggcacggctgtcagcccattctacagagagggaaaccggggctcaggcaggaagccaggtccccaagttcgcacggccaggagtggatggagctgcttttcagacccatcaccagtcctaccgtccggggcacagtgacaggttctggagggagggtgggtcccgggccaggtgctggtggggccctcgtgtggaggtgggctgatgctgggcgtgtcatcatcgtcagcccgttcctcacttccccacagaccccaggccctgtgcctgtcccctgcggacgcacggccagcatctgctctgtccaacccagtcgcattgcccaagagctctgagcaaggaggctgtcacgggaccgaggacccgctgggactggcaagcacggctggcccagtgcagcaggagggaccctgagccatgggatgggacagcctgggccagcgccaccccccggggacagaagtgcggggccagggcaggagctgcagtagctaccctccccatctccagcccgggctccccagatcactcccagatcaccagggcaccccatctctaggcagcacctcacacaccagtcctgtggcccaacacccagccatcacccaatgtcaccgtgcaccaggcactggggatgccgcagtaagcacaagaaagattttttttcaaaagctaaaccaggccaggtgcggtggctcatgcctgtaatcccagtgctttgggaggctgaggtgggaggattgcttgagaccagcctgggtgacatagcaagtccccgtctccacaaacatttttaaaatgtgccgggtgtagtggtgcacacctgtcatcccagctacccaagaagctgagacaagaggatcgcttgagcccaggtcgctgtgaccacaccgctgcactccagcctgtgcaacagagccagacctgactcaaaacaaataaaaaacaaatctaaaa

//