LOCUS       XM_029726743             493 bp    mRNA    linear   VRT 10-JUL-2025
DEFINITION  PREDICTED: Salmo trutta RNA binding protein fox-1 homolog 1
            (LOC115170528), mRNA.
ACCESSION   XM_029726743
VERSION     XM_029726743.1
DBLINK      BioProject: PRJNA550988
KEYWORDS    RefSeq; includes ab initio.
SOURCE      Salmo trutta (river trout)
  ORGANISM  Salmo trutta
            Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
            Actinopterygii; Neopterygii; Teleostei; Protacanthopterygii;
            Salmoniformes; Salmonidae; Salmoninae; Salmo.
COMMENT     MODEL REFSEQ:  This record is predicted by automated computational
            analysis. This record is derived from a genomic sequence
            (NC_042988.1) annotated using gene prediction method: Gnomon.
            Also see:
                Documentation of NCBI's Annotation Process
            
            ##Genome-Annotation-Data-START##
            Annotation Provider         :: NCBI RefSeq
            Annotation Status           :: Updated annotation
            Annotation Name             :: GCF_901001165.1-RS_2025_07
            Annotation Pipeline         :: NCBI eukaryotic genome annotation
                                           pipeline
            Annotation Software Version :: 10.4
            Annotation Method           :: Gnomon; cmsearch; tRNAscan-SE
            Features Annotated          :: Gene; mRNA; CDS; ncRNA
            Annotation Date             :: 07/09/2025
            ##Genome-Annotation-Data-END##
            
            ##RefSeq-Attributes-START##
            ab initio :: 7% of CDS bases
            ##RefSeq-Attributes-END##
FEATURES             Location/Qualifiers
     source          1..493
                     /organism="Salmo trutta"
                     /mol_type="mRNA"
                     /db_xref="taxon:8032"
                     /chromosome="32"
     gene            1..493
                     /gene="LOC115170528"
                     /note="RNA binding protein fox-1 homolog 1; Derived by
                     automated computational analysis using gene prediction
                     method: Gnomon. Supporting evidence includes similarity
                     to: 94% coverage of the annotated genomic feature by
                     RNAseq alignments, including 10 samples with support for
                     all annotated introns"
                     /db_xref="GeneID:115170528"
     CDS             179..493
                     /gene="LOC115170528"
                     /codon_start=1
                     /product="RNA binding protein fox-1 homolog 1"
                     /protein_id="XP_029582603.1"
                     /db_xref="GeneID:115170528"
                     /translation="

MEEKEEGKMVEQGNQEAPPPPDSMTQPYPSAQFAPPQNGLPAEFTASHPHPAPPDYTGQPPVSEHPLNMYPTSQNHSEQSGQDTSIQPVSATATVRHLYFITTS"

ORIGIN      

cactcacacacacacacatacactgaacacacacacacgcacacactgaacacacccacacacggggaacccacgccccatccataattgatgctagctgtgggcaggcagatgctggaggcaggaggaagaagggaggaagaagggagggaaggagggaaagcagctggatgtgtttatggaggagaaagaggaaggcaagatggtggagcagggtaaccaggaagcccctccccctccagactccatgactcagccgtacccctccgcccaatttgccccccctcagaacggcttgcccgctgagttcaccgcctctcaccctcaccctgcgccccccgactacacaggacagccccccgtcagtgaacaccccctcaacatgtaccccacttcacagaaccacagtgaacagagtggacaggacaccagcatacagcccgtctcagccacagccacagtaagacatctctactttattacaacatcttga

//