GGRNA ver.2 Home | Help | Advanced search    Previous release (v1)

2025-04-03 19:42:53, GGRNA.v2 : RefSeq release 228 (Jan, 2025)

LOCUS       XM_024118053             702 bp    mRNA    linear   MAM 14-APR-2023
DEFINITION  PREDICTED: Physeter catodon leucine-rich repeat-containing protein
            37A3-like (LOC112063147), partial mRNA.
ACCESSION   XM_024118053
VERSION     XM_024118053.2
DBLINK      BioProject: PRJNA434122
KEYWORDS    RefSeq; includes ab initio.
SOURCE      Physeter macrocephalus (sperm whale)
  ORGANISM  Physeter macrocephalus
            Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
            Mammalia; Eutheria; Laurasiatheria; Artiodactyla; Whippomorpha;
            Cetacea; Odontoceti; Physeteridae; Physeter.
COMMENT     MODEL REFSEQ:  This record is predicted by automated computational
            analysis. This record is derived from a genomic sequence
            (NW_021149317.1) annotated using gene prediction method: Gnomon.
            Also see:
                Documentation of NCBI's Annotation Process
            
            On Apr 14, 2023 this sequence version replaced XM_024118053.1.
            
            ##Genome-Annotation-Data-START##
            Annotation Provider         :: NCBI RefSeq
            Annotation Status           :: Full annotation
            Annotation Name             :: GCF_002837175.3-RS_2023_04
            Annotation Pipeline         :: NCBI eukaryotic genome annotation
                                           pipeline
            Annotation Software Version :: 10.1
            Annotation Method           :: Best-placed RefSeq; Gnomon;
                                           cmsearch; tRNAscan-SE
            Features Annotated          :: Gene; mRNA; CDS; ncRNA
            Annotation Date             :: 04/05/2023
            ##Genome-Annotation-Data-END##
            
            ##RefSeq-Attributes-START##
            ab initio :: 32% of CDS bases
            ##RefSeq-Attributes-END##
            COMPLETENESS: incomplete on the 3' end.
FEATURES             Location/Qualifiers
     source          1..702
                     /organism="Physeter macrocephalus"
                     /mol_type="mRNA"
                     /isolate="SW-GA"
                     /db_xref="taxon:9755"
                     /chromosome="Unknown"
                     /sex="female"
                     /tissue_type="muscle"
                     /dev_stage="adult"
     gene            1..>702
                     /gene="LOC112063147"
                     /note="leucine-rich repeat-containing protein 37A3-like;
                     Derived by automated computational analysis using gene
                     prediction method: Gnomon. Supporting evidence includes
                     similarity to: 1 Protein"
                     /db_xref="GeneID:112063147"
     CDS             1..>702
                     /gene="LOC112063147"
                     /codon_start=1
                     /product="leucine-rich repeat-containing protein
                     37A3-like"
                     /protein_id="XP_023973821.2"
                     /db_xref="GeneID:112063147"
                     /translation="
MSLLKPVELALIVTPAFTNEVETSPPQQETLAPFTVSPEQLEILSVQQEVSDQHPTPSENVEPSPIQQGAPTQPTYFEVTFPNPEQVQAQHPTLTEVTIQPLDLELTIRPEPTKEGEPSPSMQETLTQPPEPPKEVFVAQPPLYQNPIVPTPVQDHTEPPTSPSVRVQPLDQGLTTTPEPTMEAEHSTPLQEAIVPPTHPEVTLPNPEQVQAQHPTLTEVTIQPLDLELTIRPE"
     misc_feature    181..360
                     /gene="LOC112063147"
                     /note="Leucine-rich repeat-containing protein 37 family;
                     Region: LRRC37; pfam15779"
                     /db_xref="CDD:434930"
     misc_feature    343..564
                     /gene="LOC112063147"
                     /note="Leucine-rich repeat-containing protein 37 family;
                     Region: LRRC37; pfam15779"
                     /db_xref="CDD:434930"
     misc_feature    <586..702
                     /gene="LOC112063147"
                     /note="Leucine-rich repeat-containing protein 37 family;
                     Region: LRRC37; pfam15779"
                     /db_xref="CDD:434930"
ORIGIN      
atgtcactgttaaaacctgtggaacttgcacttatcgtaactccagcattcactaatgaggttgaaacttctccaccccaacaagaaaccttggctccgtttacagtgtcccctgagcagttggaaattttgtcggtccagcaagaggtttcagatcagcatccaaccccctctgaaaatgttgaaccttctccaatacagcagggagcccccactcaaccaacatacttcgaggttacatttccaaatccagagcaagttcaggctcagcatccaaccttgactgaggtcacaattcaacctttggaccttgaactgaccataaggccagaacccactaaggaaggtgaaccttctccatccatgcaggagaccttaacccagcctccagaaccacctaaggaggtttttgtagctcagcctccactatatcagaacccaatagttccaacaccagttcaggatcacactgagcctccaacatcacccagtgtcagagttcaacctttagaccagggacttaccacaactccagaacctactatggaggctgaacattccacacccctgcaggaggctatagttcctccaacacaccccgaggtgacacttcctaatccagagcaagttcaggctcagcatccaaccttgactgaggtcacaattcaacctttggaccttgaactgaccataaggccagaa
//

by @meso_cacase at DBCLS
This page is licensed under a Creative Commons Attribution 4.0 International License (CC BY 4.0).

If you use GGRNA in your work, please cite:
Naito Y, Bono H. (2012)
GGRNA: an ultrafast, transcript-oriented search engine for genes and transcripts.
Nucleic Acids Res., 40, W592-W596. [Full Text]