GGRNA ver.2 Home | Help | Advanced search    Previous release (v1)

2025-04-03 19:45:52, GGRNA.v2 : RefSeq release 228 (Jan, 2025)

LOCUS       XM_022439157            2194 bp    mRNA    linear   INV 14-SEP-2017
DEFINITION  PREDICTED: Crassostrea virginica CUB and sushi domain-containing
            protein 2-like (LOC111104980), mRNA.
ACCESSION   XM_022439157
VERSION     XM_022439157.1
DBLINK      BioProject: PRJNA379157
KEYWORDS    RefSeq; includes ab initio.
SOURCE      Crassostrea virginica (eastern oyster)
  ORGANISM  Crassostrea virginica
            Eukaryota; Metazoa; Spiralia; Lophotrochozoa; Mollusca; Bivalvia;
            Autobranchia; Pteriomorphia; Ostreida; Ostreoidea; Ostreidae;
            Crassostrea.
COMMENT     MODEL REFSEQ:  This record is predicted by automated computational
            analysis. This record is derived from a genomic sequence
            (NC_035786.1) annotated using gene prediction method: Gnomon.
            Also see:
                Documentation of NCBI's Annotation Process
            
            ##Genome-Annotation-Data-START##
            Annotation Provider         :: NCBI
            Annotation Status           :: Full annotation
            Annotation Version          :: Crassostrea virginica Annotation
                                           Release 100
            Annotation Pipeline         :: NCBI eukaryotic genome annotation
                                           pipeline
            Annotation Software Version :: 7.4
            Annotation Method           :: Best-placed RefSeq; Gnomon
            Features Annotated          :: Gene; mRNA; CDS; ncRNA
            ##Genome-Annotation-Data-END##
            
            ##RefSeq-Attributes-START##
            ab initio :: 1% of CDS bases
            ##RefSeq-Attributes-END##
FEATURES             Location/Qualifiers
     source          1..2194
                     /organism="Crassostrea virginica"
                     /mol_type="mRNA"
                     /isolate="RU13XGHG1-28"
                     /isolation_source="Rutgers Haskin Shellfish Research
                     Laboratory inbred lines (NJ)"
                     /db_xref="taxon:6565"
                     /chromosome="7"
                     /tissue_type="whole sample"
                     /geo_loc_name="USA"
                     /collection_date="22-Mar-2015"
     gene            1..2194
                     /gene="LOC111104980"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Gnomon. Supporting evidence
                     includes similarity to: 98% coverage of the annotated
                     genomic feature by RNAseq alignments, including 6 samples
                     with support for all annotated introns"
                     /db_xref="GeneID:111104980"
     CDS             80..2194
                     /gene="LOC111104980"
                     /codon_start=1
                     /product="CUB and sushi domain-containing protein 2-like"
                     /protein_id="XP_022294865.1"
                     /db_xref="GeneID:111104980"
                     /translation="
MTLNSTCKADGTWTSSASVCPTGPPECPVDHPDANLTNVKVTSTSIGTTLSYTCHWNKSMTLNSTCKADGTWTSSASVCPTGPPECPVDHPDANLTNVKVTSTSIGTTLSYTCHWNKSMTLNSTCKADGTWTSSASVCPTGPPECPVDHPDANLTNVKVTSTSIGTTLSYTCHWNKSMTLNSTCKADGTWTSSASVCPTGPPECPVDHPDANLTNVKVTSTSIGTTLSYTCHWNKSMTLNSTCKADGTWTSSASVCPTGPPECPVDHPDANLTNVKVTSTSIGTTLSYTCHWNKSMTLNSTCKADGTWTSSASVCPTGPPECPVDHPDANLTNVKVTSTSIGTTLSYTCHWNKSMTLNSTCKADGTWTSSASVCPTGPPECPVDHPDANLTNVKVTSTSIGTTLSYTCHWNKSMTLNSTCKADGTWTSSASVCPTGPPECPVDHPDANLTNVKVTSTSIGTTLSYTCHWNKSMTLNSTCKADGTWTSSASVCPTGPPECPVDHPDANLTNVKVTSTSIGTTLSYTCHWNKSMTLNSTCKADGTWTSSASVCPTGPPECPVDHPDANLTNVKVTSTSIGTTLSYTCHWNKSMTLNSTCKADGTWTSSASVCPTGPPECPVDHPDANLTNVKVTSTSIGTTLSYTCHWNKSMTLNSTCKADGTWTSSASVCPTGPPECPVDHPDANLTNVKVTSTSIGTTLSYTTR"
ORIGIN      
cgcaaacttaaccaatgtcaaggtcacttccactagcatcgggacgactctttcttacacatgtcattggaataaatcaatgaccttgaactcaacatgcaaagctgatggtacctggacatcttcggcttccgtttgccctaccggcccaccagaatgccctgttgatcaccctgacgcaaacttaaccaatgtcaaggtcacttccactagcatcgggacgactctttcttacacatgtcattggaataaatcaatgaccttgaactcaacatgcaaagctgatggtacctggacatcttcggcttccgtttgccctaccggcccaccagaatgccctgttgatcaccctgacgcaaacttaaccaatgtcaaggtcacttccactagcatcgggacgactctttcttacacatgtcattggaataaatcaatgaccttgaactcaacatgcaaagctgatggtacctggacatcttcggcttccgtttgccctaccggcccaccagaatgccctgttgatcaccctgacgcaaacttaaccaatgtcaaggtcacttccactagcatcgggacgactctttcttacacatgtcattggaataaatcaatgaccttgaactcaacatgcaaagctgatggtacctggacatcttcggcttccgtttgccctaccggcccaccagaatgccctgttgatcaccctgacgcaaacttaaccaatgtcaaggtcacttccactagcatcgggacgactctttcttacacatgtcattggaataaatcaatgaccttgaactcaacatgcaaagctgatggtacctggacatcttcggcttccgtttgccctaccggcccaccagaatgccctgttgatcaccctgacgcaaacttaaccaatgtcaaggtcacttccactagcatcgggacgactctttcttacacatgtcattggaataaatcaatgaccttgaactcaacatgcaaagctgatggtacctggacatcttcggcttccgtttgccctaccggcccaccagaatgccctgttgatcaccctgacgcaaacttaaccaatgtcaaggtcacttccactagcatcgggacgactctttcttacacatgtcattggaataaatcaatgaccttgaactcaacatgcaaagctgatggtacctggacatcttcggcttccgtttgccctaccggcccaccagaatgccctgttgatcaccctgacgcaaacttaaccaatgtcaaggtcacttccactagcatcgggacgactctttcttacacatgtcattggaataaatcaatgaccttgaactcaacatgcaaagctgatggtacctggacatcttcggcttccgtttgccctaccggcccaccagaatgccctgttgatcaccctgacgcaaacttaaccaatgtcaaggtcacttccactagcatcgggacgactctttcttacacatgtcattggaataaatcaatgaccttgaactcaacatgcaaagctgatggtacctggacatcttcggcttccgtttgccctaccggcccaccagaatgccctgttgatcaccctgacgcaaacttaaccaatgtcaaggtcacttccactagcatcgggacgactctttcttacacatgtcattggaataaatcaatgaccttgaactcaacatgcaaagctgatggtacctggacatcttcggcttccgtttgccctaccggcccaccagaatgccctgttgatcaccctgacgcaaacttaaccaatgtcaaggtcacttccactagcatcgggacgactctttcttacacatgtcattggaataaatcaatgaccttgaactcaacatgcaaagctgatggtacctggacatcttcggcttccgtttgccctaccggcccaccagaatgccctgttgatcaccctgacgcaaacttaaccaatgtcaaggtcacttccactagcatcgggacgactctttcttacacatgtcattggaataaatcaatgaccttgaactcaacatgcaaagctgatggtacctggacatcttcggcttccgtttgccctaccggcccaccagaatgccctgttgatcaccctgacgcaaacttaaccaatgtcaaggtcacttccactagcatcgggacgactctttcttacaccactcggtaa
//

by @meso_cacase at DBCLS
This page is licensed under a Creative Commons Attribution 4.0 International License (CC BY 4.0).

If you use GGRNA in your work, please cite:
Naito Y, Bono H. (2012)
GGRNA: an ultrafast, transcript-oriented search engine for genes and transcripts.
Nucleic Acids Res., 40, W592-W596. [Full Text]