2024-04-26 11:22:10, GGRNA.v2 : RefSeq release 222 (Jan, 2024)
LOCUS XM_021711502 1048 bp mRNA linear PRI 01-JUL-2017 DEFINITION PREDICTED: Carlito syrichta vimentin (VIM), transcript variant X2, mRNA. ACCESSION XM_021711502 VERSION XM_021711502.1 DBLINK BioProject: PRJNA236776 KEYWORDS RefSeq. SOURCE Carlito syrichta (Philippine tarsier) ORGANISM Carlito syrichta Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini; Tarsiiformes; Tarsiidae; Carlito. COMMENT MODEL REFSEQ: This record is predicted by automated computational analysis. This record is derived from a genomic sequence (NW_007246423.1) annotated using gene prediction method: Gnomon, supported by EST evidence. Also see: Documentation of NCBI's Annotation Process ##Genome-Annotation-Data-START## Annotation Provider :: NCBI Annotation Status :: Full annotation Annotation Version :: Carlito syrichta Annotation Release 101 Annotation Pipeline :: NCBI eukaryotic genome annotation pipeline Annotation Software Version :: 7.4 Annotation Method :: Best-placed RefSeq; Gnomon Features Annotated :: Gene; mRNA; CDS; ncRNA ##Genome-Annotation-Data-END## FEATURES Location/Qualifiers source 1..1048 /organism="Carlito syrichta" /mol_type="mRNA" /isolate="Samal-C Ts95f" /db_xref="taxon:1868482" /chromosome="Unknown" /sex="female" /country="USA: Duke University Lemur Center, Durham, NC" gene 1..1048 /gene="VIM" /note="Derived by automated computational analysis using gene prediction method: Gnomon. Supporting evidence includes similarity to: 2052 ESTs, 1 Protein, and 94% coverage of the annotated genomic feature by RNAseq alignments, including 1 sample with support for all annotated introns" /db_xref="GeneID:103258679" CDS 35..727 /gene="VIM" /codon_start=1 /product="vimentin isoform X2" /protein_id="XP_021567177.1" /db_xref="GeneID:103258679" /translation="
MMRLEIQELQAQIQEQHVQIDVDVSKPDLTAALRDVRQQYESVAAKNLQEAEEWYKSKFADLSEAANRNNDALRQAKQESNEYRRQVQSLTCEVDALKGTNESLERQMREMEENFAVEAANYQDTIGRLQDEIQNMKEEMARHLREYQDLLNVKMALDIEIATYRKLLEGEESRISLPLPNFSSLNLRETNLDSLPLVDTHSKRTLLIKTVETRDGQVINETSQHHDDLE"
misc_feature <47..556 /gene="VIM" /note="Intermediate filament protein; Region: Filament; pfam00038" /db_xref="CDD:425436" ORIGIN
ttgcaagaagagatcgcctttttgaagaaactgcatgatgaggttggaaatccaggagctgcaggcccagatccaggaacagcatgtccagatcgatgtggacgtctccaagcccgacctcacggctgccctacgtgatgtacgccagcagtatgaaagtgtggctgccaaaaaccttcaggaggcagaagaatggtacaagtccaagtttgctgacctctctgaggctgctaaccggaacaatgatgccctgcgccaggcgaagcaggagtccaacgagtaccggagacaggtgcagtccctcacctgtgaagtggatgcccttaaaggaactaatgagtccctggaacgccagatgcgtgaaatggaagaaaactttgctgttgaagctgctaactaccaagacactattggccgcctgcaggatgagattcagaacatgaaggaagaaatggctcgtcaccttcgtgaataccaagacttgctcaatgtcaagatggctcttgacatcgagattgccacctacaggaagctgctggaaggcgaggagagcaggatttcgctgcctcttccaaacttttcctccctgaacctgagggaaactaacctggattcactccctctggttgatactcactcaaaaaggacccttctgattaagacagttgaaactagagatggacaggttatcaatgaaacttctcagcatcacgatgatcttgaatgaaaattgcacacacacagtgcagcaatatattaccagcaagaataaaaaagaaatccatatcttaaagaaacagctttcaagtgcctttctgcagtttttcaggagcgcaagatagatttggaataggaataaactctagttcttaacaaccgacactcctaagagatttagacaaacgtttacaacataatctagtttacgaagaagtcttgtgctagaatactttttaaaaagtatttttgaataccattaaaactgctttttttccagcaagtatccgaccaacttgtttctgcttcaataaatctttggaaaaactct
//
by
@meso_cacase at
DBCLS
This page is licensed under a
Creative Commons Attribution 4.0 International License (CC BY 4.0).
If you use GGRNA in your work, please cite:
Naito Y, Bono H. (2012)
GGRNA: an ultrafast, transcript-oriented search engine for genes and transcripts.
Nucleic Acids Res., 40, W592-W596.
[Full Text]