ver.2
Home
|
Help
|
Advanced search
Previous release (v1)
2025-12-09 09:31:31, GGRNA.v2 : RefSeq release 232 (Sep, 2025)
LOCUS XM_020573799 198 bp mRNA linear INV 17-MAR-2017
DEFINITION Polysphondylium pallidum PN500 40S ribosomal protein S30 (rps30-2),
partial mRNA.
ACCESSION XM_020573799
VERSION XM_020573799.1
DBLINK BioProject: PRJNA46447
BioSample: SAMN02953767
KEYWORDS RefSeq.
SOURCE Heterostelium album PN500
ORGANISM Heterostelium album PN500
Eukaryota; Amoebozoa; Evosea; Eumycetozoa; Dictyostelia;
Acytosteliales; Acytosteliaceae; Heterostelium.
REFERENCE 1 (bases 1 to 198)
AUTHORS Gloeckner,G., Schaap,P., Noegel,A.A., Felder,M., Eichinger,L.,
Heidel,A.J. and Platzer,M.
TITLE Living fossils from the dawn of multicellularity
JOURNAL Unpublished
REFERENCE 2 (bases 1 to 198)
CONSRTM NCBI Genome Project
TITLE Direct Submission
JOURNAL Submitted (17-MAR-2017) National Center for Biotechnology
Information, NIH, Bethesda, MD 20894, USA
REFERENCE 3 (bases 1 to 198)
AUTHORS Gloeckner,G., Schaap,P., Noegel,A.A., Felder,M. and Platzer,M.
TITLE Direct Submission
JOURNAL Submitted (11-DEC-2009) Genome Analysis, Fritz Lipmann Institute,
Beutenbergstr. 11, Jena 07745, Germany
COMMENT PROVISIONAL REFSEQ: This record has not yet been subject to final
NCBI review. This record is derived from an annotated genomic
sequence (NW_008805065).
COMPLETENESS: incomplete on both ends.
FEATURES Location/Qualifiers
source 1..198
/organism="Heterostelium album PN500"
/mol_type="mRNA"
/strain="PN500"
/db_xref="taxon:670386"
/chromosome="Unknown"
gene <1..>198
/gene="rps30-2"
/locus_tag="PPL_02821"
/db_xref="GeneID:31358344"
CDS 1..198
/gene="rps30-2"
/locus_tag="PPL_02821"
/codon_start=1
/product="40S ribosomal protein S30"
/protein_id="XP_020435871.1"
/db_xref="GeneID:31358344"
/translation="
MGKVHGGLNRAGKVRNATPNVEKKEVRKPKVGRAKKRLLYNRRFVNVVVGFGKKKGYNTQNVPNV"
misc_feature 7..180
/gene="rps30-2"
/locus_tag="PPL_02821"
/note="Ribosomal protein S30; Region: Ribosomal_S30;
pfam04758"
/db_xref="CDD:398432"
ORIGIN
atgggtaaggttcacggtggtttgaacagagctggtaaagtcagaaacgctactccaaacgttgagaagaaggaggtcagaaagccaaaggttggtcgtgccaagaagagattgttgtacaaccgtcgtttcgtcaacgttgtcgttggtttcggaaagaagaagggttacaacactcaaaacgtcccaaatgtctaa
//
by
@meso_cacase at
DBCLS
This page is licensed under a
Creative Commons Attribution 4.0 International License (CC BY 4.0).
If you use GGRNA in your work, please cite:
Naito Y, Bono H. (2012)
GGRNA: an ultrafast, transcript-oriented search engine for genes and transcripts.
Nucleic Acids Res., 40, W592-W596.
[Full Text]