2024-04-24 21:56:40, GGRNA.v2 : RefSeq release 222 (Jan, 2024)
LOCUS XM_020078377 630 bp mRNA linear VRT 08-FEB-2017 DEFINITION PREDICTED: Paralichthys olivaceus mitofusin-1-like (LOC109623919), partial mRNA. ACCESSION XM_020078377 VERSION XM_020078377.1 DBLINK BioProject: PRJNA369269 KEYWORDS RefSeq. SOURCE Paralichthys olivaceus (Japanese flounder) ORGANISM Paralichthys olivaceus Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Actinopterygii; Neopterygii; Teleostei; Neoteleostei; Acanthomorphata; Carangaria; Pleuronectiformes; Pleuronectoidei; Paralichthyidae; Paralichthys. COMMENT MODEL REFSEQ: This record is predicted by automated computational analysis. This record is derived from a genomic sequence (NW_017868986.1) annotated using gene prediction method: Gnomon. Also see: Documentation of NCBI's Annotation Process ##Genome-Annotation-Data-START## Annotation Provider :: NCBI Annotation Status :: Full annotation Annotation Version :: Paralichthys olivaceus Annotation Release 100 Annotation Pipeline :: NCBI eukaryotic genome annotation pipeline Annotation Software Version :: 7.2 Annotation Method :: Best-placed RefSeq; Gnomon Features Annotated :: Gene; mRNA; CDS; ncRNA ##Genome-Annotation-Data-END## COMPLETENESS: incomplete on the 3' end. FEATURES Location/Qualifiers source 1..630 /organism="Paralichthys olivaceus" /mol_type="mRNA" /db_xref="taxon:8255" /chromosome="Unknown" /sex="female" /tissue_type="blood" /dev_stage="adult" /breed="gynogenesis" gene 1..>630 /gene="LOC109623919" /note="Derived by automated computational analysis using gene prediction method: Gnomon. Supporting evidence includes similarity to: 100% coverage of the annotated genomic feature by RNAseq alignments, including 8 samples with support for all annotated introns" /db_xref="GeneID:109623919" CDS 200..>630 /gene="LOC109623919" /codon_start=1 /product="mitofusin-1-like" /protein_id="XP_019933936.1" /db_xref="GeneID:109623919" /translation="
MSEAWRSDDLGQVAVEEQSVDMQSCATKLSTIRDVLLRRHMKVAFFGRTSNGKSTVINAMLRDRVLPSGIGHTTNCFLRVEGTDGDEAYLTTEASNERRSVTTVNQLAHALHMDPTLDSGSLVRVFWPKSCCALLRDDLVLMD"
misc_feature 326..>630 /gene="LOC109623919" /note="P-loop containing Nucleoside Triphosphate Hydrolases; Region: P-loop_NTPase; cl38936" /db_xref="CDD:453896" misc_feature 338..361 /gene="LOC109623919" /note="G1 box; other site" /db_xref="CDD:206648" misc_feature 419..421 /gene="LOC109623919" /note="G2 box; other site" /db_xref="CDD:206648" misc_feature 425..433 /gene="LOC109623919" /note="Switch I region; other site" /db_xref="CDD:206648" ORIGIN
acatgttacgttcacgatgaggtcactatgacctttgacctctgaaatctaatcaattcatctttcaaccagttttgaggaaattccttcgaggtgttgttgagatatcgtgttgacaagaaagaaacagcctctgaccactgggggtcgctggtgtaaacaatacaaacgtgacaatgtgacctgtgtttgttgcgtgatgtcagaggcatggcggagcgacgacctgggccaggtggcggtggaggagcagagcgtggacatgcagagctgtgccaccaaactgtcgaccatcagggacgttttgctgcggaggcacatgaaggtggcgttctttggcagaactagtaacgggaaaagtaccgtgatcaacgccatgttgagagaccgagtgttgcccagcggcattggtcacaccaccaactgcttcctgagggtggaaggaaccgacggagacgaggcttacctcaccaccgaggcgtccaatgagaggcggagcgtcactacggtcaaccagctcgctcacgcgctccacatggatccaactctagattccggcagcctcgtcagagtgttctggcctaaaagttgctgcgctctgctgagagacgacctggtgctgatggacag
//
by
@meso_cacase at
DBCLS
This page is licensed under a
Creative Commons Attribution 4.0 International License (CC BY 4.0).
If you use GGRNA in your work, please cite:
Naito Y, Bono H. (2012)
GGRNA: an ultrafast, transcript-oriented search engine for genes and transcripts.
Nucleic Acids Res., 40, W592-W596.
[Full Text]