2025-06-07 19:33:03, GGRNA.v2 : RefSeq release 229 (Mar, 2025)
LOCUS XM_018882878 681 bp mRNA linear PLN 07-JAN-2024 DEFINITION Sugiyamaella lignohabitans bifunctional glutathione transferase/peroxidase (GTT1), partial mRNA. ACCESSION XM_018882878 VERSION XM_018882878.1 DBLINK BioProject: PRJNA342695 BioSample: SAMN04417247 KEYWORDS RefSeq. SOURCE Sugiyamaella lignohabitans ORGANISM Sugiyamaella lignohabitans Eukaryota; Fungi; Dikarya; Ascomycota; Saccharomycotina; Dipodascomycetes; Dipodascales; Trichomonascaceae; Sugiyamaella. REFERENCE 1 (bases 1 to 681) AUTHORS Bellasio,M., Peymann,A., Valli,M., Sipitzky,M., Graf,A., Sauer,M., Marx,H. and Mattanovich,D. TITLE Complete genome sequence and transcriptome regulation of the pentose utilising yeast Sugiyamaella lignohabitans JOURNAL Unpublished REFERENCE 2 (bases 1 to 681) CONSRTM NCBI Genome Project TITLE Direct Submission JOURNAL Submitted (04-JAN-2024) National Center for Biotechnology Information, NIH, Bethesda, MD 20894, USA REFERENCE 3 (bases 1 to 681) AUTHORS Peymann,A. and Graf,A. TITLE Direct Submission JOURNAL Submitted (18-FEB-2016) Department of Biotechnology, University of Natural Resources and Life Sciences, Muthgasse 18, Vienna, Vienna 1190, Austria COMMENT PROVISIONAL REFSEQ: This record has not yet been subject to final NCBI review. This record is derived from an annotated genomic sequence (NC_031672). COMPLETENESS: incomplete on both ends. FEATURES Location/Qualifiers source 1..681 /organism="Sugiyamaella lignohabitans" /mol_type="mRNA" /strain="CBS 10342" /type_material="culture from holotype of Candida lignohabitans" /db_xref="taxon:796027" /chromosome="A" gene <1..>681 /gene="GTT1" /locus_tag="AWJ20_908" /db_xref="GeneID:30037992" CDS 1..681 /gene="GTT1" /locus_tag="AWJ20_908" /inference="similar to AA sequence:KEGG_Orthology:K00799" /note="ER associated glutathione S-transferase capable of homodimerization; expression induced during the diauxic shift and throughout stationary phase; functional overlap with Gtt2p, Grx1p, and Grx2p; GO_component: GO:0005783 - endoplasmic reticulum [Evidence IEA]; GO_component: GO:0005783 - endoplasmic reticulum [Evidence IDA] [PMID 9792709]; GO_component: GO:0005789 - endoplasmic reticulum membrane [Evidence IEA]; GO_component: GO:0016020 - membrane [Evidence IEA]; GO_component: GO:0005741 - mitochondrial outer membrane [Evidence IDA] [PMID 16407407]; GO_component: GO:0005739 - mitochondrion [Evidence IDA] [PMID 14576278]; GO_component: GO:0005739 - mitochondrion [Evidence IDA] [PMID 16823961]; GO_component: GO:0005886 - plasma membrane [Evidence IDA] [PMID 16622836]; GO_function: GO:0004602 - glutathione peroxidase activity [Evidence IDA] [PMID 16709151]; GO_function: GO:0004364 - glutathione transferase activity [Evidence IEA]; GO_function: GO:0004364 - glutathione transferase activity [Evidence IDA,ISS] [PMID 9792709]; GO_function: GO:0016740 - transferase activity [Evidence IEA]; GO_process: GO:0006749 - glutathione metabolic process [Evidence IDA] [PMID 9792709]" /codon_start=1 /product="bifunctional glutathione transferase/peroxidase" /protein_id="XP_018735123.1" /db_xref="GeneID:30037992" /translation="
MPAQITLYDLERSRSQRIGWLLEELKVDYNVETFKRNERQRADPALFKIHPLGKAPVISVDGKIIAESAVIIDYLIKNFGQGSELEAKNEEEAFDINYYLHHSEATLQPCLLLLFVTDVTNKQAPYLLKSVAKKVTEAQDDGYALPELKLNLKYLDDKLKTNGTGFFVGDHLSGADIIYSFPLLDAKHRKFATAEDYPHIFKWIDLITARPAYKAALEKTGKPAKI"
misc_feature 13..657 /gene="GTT1" /locus_tag="AWJ20_908" /note="Glutathione S-transferase [Posttranslational modification, protein turnover, chaperones]; Region: GstA; COG0625" /db_xref="CDD:440390" ORIGIN
atgcctgcacaaattactctttatgacctcgagcgatcgcgttcgcagagaattggctggcttttggaagagctcaaggtagactataacgtcgagacgtttaagcgtaacgagcgtcagagagccgatcctgcactattcaagatccatcctctcggaaaagcaccagtgatcagtgttgatggtaagatcattgctgaaagtgctgtgatcattgactatctgatcaagaattttggtcaaggaagtgagctcgaggccaagaacgaagaagaggcctttgatatcaactactatctccaccactccgaggccactcttcagccatgtttgttattgctgttcgtcaccgacgtgacaaacaaacaagctccctacctcctcaaatcagttgccaaaaaggtcaccgaggcccaagacgatggctatgctctgcccgaactcaagctcaacctgaagtacctcgacgacaagctcaagaccaacggcaccggtttcttcgtcggcgaccatctctccggtgccgacatcatctactcgttcccactactcgacgccaaacaccgcaagttcgcgaccgccgaggactacccccatatcttcaagtggatcgatctcattaccgcccgtcccgcctacaaagccgctctcgagaagaccggcaagcctgctaaaatctaa
//
by
@meso_cacase at
DBCLS
This page is licensed under a
Creative Commons Attribution 4.0 International License (CC BY 4.0).
If you use GGRNA in your work, please cite:
Naito Y, Bono H. (2012)
GGRNA: an ultrafast, transcript-oriented search engine for genes and transcripts.
Nucleic Acids Res., 40, W592-W596.
[Full Text]