2025-04-03 20:11:07, GGRNA.v2 : RefSeq release 228 (Jan, 2025)
LOCUS XM_018881475 720 bp mRNA linear PLN 07-JAN-2024 DEFINITION Sugiyamaella lignohabitans Pbn1p (PBN1), partial mRNA. ACCESSION XM_018881475 VERSION XM_018881475.1 DBLINK BioProject: PRJNA342695 BioSample: SAMN04417247 KEYWORDS RefSeq. SOURCE Sugiyamaella lignohabitans ORGANISM Sugiyamaella lignohabitans Eukaryota; Fungi; Dikarya; Ascomycota; Saccharomycotina; Dipodascomycetes; Dipodascales; Trichomonascaceae; Sugiyamaella. REFERENCE 1 (bases 1 to 720) AUTHORS Bellasio,M., Peymann,A., Valli,M., Sipitzky,M., Graf,A., Sauer,M., Marx,H. and Mattanovich,D. TITLE Complete genome sequence and transcriptome regulation of the pentose utilising yeast Sugiyamaella lignohabitans JOURNAL Unpublished REFERENCE 2 (bases 1 to 720) CONSRTM NCBI Genome Project TITLE Direct Submission JOURNAL Submitted (04-JAN-2024) National Center for Biotechnology Information, NIH, Bethesda, MD 20894, USA REFERENCE 3 (bases 1 to 720) AUTHORS Peymann,A. and Graf,A. TITLE Direct Submission JOURNAL Submitted (18-FEB-2016) Department of Biotechnology, University of Natural Resources and Life Sciences, Muthgasse 18, Vienna, Vienna 1190, Austria COMMENT PROVISIONAL REFSEQ: This record has not yet been subject to final NCBI review. This record is derived from an annotated genomic sequence (NC_031671). COMPLETENESS: incomplete on both ends. FEATURES Location/Qualifiers source 1..720 /organism="Sugiyamaella lignohabitans" /mol_type="mRNA" /strain="CBS 10342" /type_material="culture from holotype of Candida lignohabitans" /db_xref="taxon:796027" /chromosome="C" gene <1..>720 /gene="PBN1" /locus_tag="AWJ20_4408" /db_xref="GeneID:30036537" CDS 1..720 /gene="PBN1" /locus_tag="AWJ20_4408" /inference="similar to AA sequence:KEGG_Orthology:K07541" /note="Component of glycosylphosphatidylinositol-mannosyltransferase I; essential component; required for the autocatalytic post-translational processing of the protease B precursor Prb1p; localizes to ER in lumenal orientation; homolog of mammalian PIG-X; GO_component: GO:0005783 - endoplasmic reticulum [Evidence IEA]; GO_component: GO:0005783 - endoplasmic reticulum [Evidence IDA] [PMID 9649520]; GO_component: GO:0005789 - endoplasmic reticulum membrane [Evidence IEA,IEA]; GO_component: GO:0016021 - integral component of membrane [Evidence IEA]; GO_component: GO:0016020 - membrane [Evidence IEA]; GO_function: GO:0000030 - mannosyltransferase activity [Evidence IMP] [PMID 15635094]; GO_process: GO:0030433 - ER-associated ubiquitin-dependent protein catabolic process [Evidence IMP] [PMID 16418276]; GO_process: GO:0006506 - GPI anchor biosynthetic process [Evidence IEA,IEA,IEA]; GO_process: GO:0006506 - GPI anchor biosynthetic process [Evidence IMP] [PMID 15635094]; GO_process: GO:0016485 - protein processing [Evidence IMP] [PMID 9649520]" /codon_start=1 /product="Pbn1p" /protein_id="XP_018734065.1" /db_xref="GeneID:30036537" /translation="
MVRYPKQHRQLPVSSSYRADFSKPVGLHPKHNLHLSNIESPDQHCRLYSKYTIPKALFVDKYQLADLDRSTAMSTAKGKLIAVWGETDLEAPVWSVDGWGSELLVEIYHNSDIQSSDFTFELPLHSRYEFPQMNSTSVTQNLPWPIVFWVCPDFQQEQRHIGEIKGLGYESLFPDNTLYYHLTPSPEDGDVLSTSFNIPVAPFNQYDRIQWLSVTVLLTATIYILYKIVSNIGRKTKAD"
misc_feature 70..684 /gene="PBN1" /locus_tag="AWJ20_4408" /note="PIG-X / PBN1; Region: PIG-X; pfam08320" /db_xref="CDD:462426" ORIGIN
atggtgagatatccgaaacagcaccgtcaattgccagtgtccagttcgtatagagcagacttttcgaaaccagtaggccttcatcctaaacacaatctgcatctctctaatatcgagtcgcccgaccagcactgcaggttatattccaaatataccattcccaaggccctgtttgtggataagtaccaattggccgacctggatcggtcgactgccatgtctacagccaagggcaaactgatagctgtttggggagagaccgatctcgaggctcctgtatggtctgttgacggttggggaagcgagctgctggtggaaatataccacaatagcgatattcaaagcagtgatttcactttcgaactgccgcttcattctcgctatgagtttcctcagatgaacagtacatctgtcactcagaacctgccctggcctattgttttctgggtatgtcctgatttccaacaggaacagcgtcatatcggcgagatcaagggtctaggttatgaatctcttttccctgataacactctttactaccatctgacaccatctcctgaagatggggatgttctcagcacgagtttcaacatccccgtggctcctttcaaccagtacgaccgcattcagtggctgtctgtcacggttctgctcaccgctacgatatacatcctgtacaagatcgtgtcgaatatcggccgaaagaccaaagccgattag
//
by
@meso_cacase at
DBCLS
This page is licensed under a
Creative Commons Attribution 4.0 International License (CC BY 4.0).
If you use GGRNA in your work, please cite:
Naito Y, Bono H. (2012)
GGRNA: an ultrafast, transcript-oriented search engine for genes and transcripts.
Nucleic Acids Res., 40, W592-W596.
[Full Text]