GGRNA ver.2 Home | Help | Advanced search    Previous release (v1)

2025-04-03 20:07:03, GGRNA.v2 : RefSeq release 228 (Jan, 2025)

LOCUS       XM_018881454            1065 bp    mRNA    linear   PLN 07-JAN-2024
DEFINITION  Sugiyamaella lignohabitans Rtn1p (RTN1), partial mRNA.
ACCESSION   XM_018881454
VERSION     XM_018881454.1
DBLINK      BioProject: PRJNA342695
            BioSample: SAMN04417247
KEYWORDS    RefSeq.
SOURCE      Sugiyamaella lignohabitans
  ORGANISM  Sugiyamaella lignohabitans
            Eukaryota; Fungi; Dikarya; Ascomycota; Saccharomycotina;
            Dipodascomycetes; Dipodascales; Trichomonascaceae; Sugiyamaella.
REFERENCE   1  (bases 1 to 1065)
  AUTHORS   Bellasio,M., Peymann,A., Valli,M., Sipitzky,M., Graf,A., Sauer,M.,
            Marx,H. and Mattanovich,D.
  TITLE     Complete genome sequence and transcriptome regulation of the
            pentose utilising yeast Sugiyamaella lignohabitans
  JOURNAL   Unpublished
REFERENCE   2  (bases 1 to 1065)
  CONSRTM   NCBI Genome Project
  TITLE     Direct Submission
  JOURNAL   Submitted (04-JAN-2024) National Center for Biotechnology
            Information, NIH, Bethesda, MD 20894, USA
REFERENCE   3  (bases 1 to 1065)
  AUTHORS   Peymann,A. and Graf,A.
  TITLE     Direct Submission
  JOURNAL   Submitted (18-FEB-2016) Department of Biotechnology, University of
            Natural Resources and Life Sciences, Muthgasse 18, Vienna, Vienna
            1190, Austria
COMMENT     PROVISIONAL REFSEQ: This record has not yet been subject to final
            NCBI review. This record is derived from an annotated genomic
            sequence (NC_031672).
            COMPLETENESS: incomplete on both ends.
FEATURES             Location/Qualifiers
     source          1..1065
                     /organism="Sugiyamaella lignohabitans"
                     /mol_type="mRNA"
                     /strain="CBS 10342"
                     /type_material="culture from holotype of Candida
                     lignohabitans"
                     /db_xref="taxon:796027"
                     /chromosome="A"
     gene            <1..>1065
                     /gene="RTN1"
                     /locus_tag="AWJ20_439"
                     /db_xref="GeneID:30036516"
     CDS             1..1065
                     /gene="RTN1"
                     /locus_tag="AWJ20_439"
                     /note="Reticulon protein; stabilizes membrane curvature;
                     involved in nuclear pore assembly and maintenance of
                     tubular ER morphology; mutant overexpressing RTN1 shows
                     increase in tubular ER; interacts with exocyst subunit
                     Sec6p, Yip3p, and Sbh1p; more abundant than Rtn2p; member
                     of the RTNLA subfamily; mutants have reduced
                     phosphatidylserine transfer between the ER and
                     mitochondria; RTN1 has a paralog, RTN2, that arose from
                     the whole genome duplication; GO_component: GO:0005794 -
                     Golgi apparatus [Evidence IDA] [PMID 16002643];
                     GO_component: GO:0032541 - cortical endoplasmic reticulum
                     [Evidence IDA] [PMID 16624861]; GO_component: GO:0005783 -
                     endoplasmic reticulum [Evidence IEA]; GO_component:
                     GO:0005783 - endoplasmic reticulum [Evidence IDA] [PMID
                     14562095]; GO_component: GO:0005783 - endoplasmic
                     reticulum [Evidence IDA] [PMID 16002643]; GO_component:
                     GO:0005789 - endoplasmic reticulum membrane [Evidence
                     IEA]; GO_component: GO:0071782 - endoplasmic reticulum
                     tubular network [Evidence IDA] [PMID 16469703];
                     GO_component: GO:0030176 - integral component of
                     endoplasmic reticulum membrane [Evidence IDA] [PMID
                     16624861]; GO_component: GO:0016021 - integral component
                     of membrane [Evidence IEA]; GO_component: GO:0016020 -
                     membrane [Evidence IEA]; GO_component: GO:0005739 -
                     mitochondrion [Evidence IDA] [PMID 14576278];
                     GO_component: GO:0005739 - mitochondrion [Evidence IDA]
                     [PMID 16823961]; GO_function: GO:0003674 -
                     molecular_function [Evidence ND]; GO_process: GO:0007029 -
                     endoplasmic reticulum organization [Evidence IGI] [PMID
                     19665976]; GO_process: GO:0071788 - endoplasmic reticulum
                     tubular network maintenance [Evidence IGI] [PMID
                     21502358]; GO_process: GO:0071786 - endoplasmic reticulum
                     tubular network organization [Evidence IGI,IMP] [PMID
                     16469703]; GO_process: GO:0071786 - endoplasmic reticulum
                     tubular network organization [Evidence IMP] [PMID
                     16624861]; GO_process: GO:0071786 - endoplasmic reticulum
                     tubular network organization [Evidence IGI] [PMID
                     18309084]; GO_process: GO:0071786 - endoplasmic reticulum
                     tubular network organization [Evidence IGI] [PMID
                     18442980]; GO_process: GO:0071786 - endoplasmic reticulum
                     tubular network organization [Evidence IGI,IPI] [PMID
                     19665976]; GO_process: GO:0051292 - nuclear pore complex
                     assembly [Evidence IGI] [PMID 19273614]"
                     /codon_start=1
                     /product="Rtn1p"
                     /protein_id="XP_018734672.1"
                     /db_xref="GeneID:30036516"
                     /translation="
MSGTGPLAPGAATLDHTSSSVPVSTPVAGSTTGAPVTKNSLRSRLPPVLTWENPVRSGTVLAEILGVLIVLRYANLVRLALRFTYIAIGVTGAAEFATRHLYGSSTGFVSSYRPSRFIHLNQASIEKYASCATKAVVHSVNDAKRLLDAEDLSLSLGSFITVFVLYVLTGFLSISTLLIISAVALFAVPPIYLQFQTEIDDLLAHFHKQAHEHYKNAHGQVMNAAGPHLDVAKKHFNNVASAVGINRGGFPVGSTGSKQDIPTKPAEPVDVPGGAAITPSTPIPEKKAPRLSEDASAILKSHEATQNIDSVPTILGNVSLDPHASSTPHHVPPTTTAQDYISEIADNTTQTSSL"
     misc_feature    142..618
                     /gene="RTN1"
                     /locus_tag="AWJ20_439"
                     /note="Region: Reticulon; pfam02453"
                     /db_xref="CDD:460562"
ORIGIN      
atgtctggaactggtcctcttgctcctggcgctgccactcttgatcacaccagcagttctgtccctgtctcgactcctgttgctggctctactactggtgctcctgtcaccaagaacagtcttcgttcgagacttcctcctgtgttgacctgggagaaccctgttcgatccggcactgttctcgccgagatcctgggtgttcttatcgttctccgatacgccaatctcgtgcgattggctcttcgttttacttatattgccattggtgtcactggtgctgctgagtttgctacccgacacttgtacggcagttcgaccggatttgtttcctcttaccgtccttctcgtttcatccatctcaaccaagcttctattgaaaagtatgcttcctgtgccaccaaggctgttgtccactctgtcaatgatgccaagagacttctcgatgccgaagacttgtctttgtctttgggatctttcatcactgtctttgtcctgtatgttttgacaggtttcttgtctatctcgactcttttgatcatttctgcagtggctctatttgccgttcctcctatttacctgcaattccagaccgagatcgatgatttgcttgctcatttccacaaacaagcccacgagcactacaagaacgctcatggtcaagtcatgaacgctgctggaccccatctcgacgttgccaagaagcacttcaacaatgtggcctctgctgttggtattaaccgtggagggttccctgtaggctcgaccggcagcaagcaagacatccccaccaaacccgccgagcccgtcgacgttcccggcggagctgccatcactccctcgactcccatccccgaaaagaaggctccccgcctgtccgaagacgcctcggccatcctcaaatcgcacgaagccactcaaaacatcgactcggtccccactattctcggcaacgtctccctcgatccccacgcctcgtccacccctcaccacgttcctcccaccaccactgcccaagactacatctccgaaatcgctgacaacaccacccagacctcctctctctaa
//

by @meso_cacase at DBCLS
This page is licensed under a Creative Commons Attribution 4.0 International License (CC BY 4.0).

If you use GGRNA in your work, please cite:
Naito Y, Bono H. (2012)
GGRNA: an ultrafast, transcript-oriented search engine for genes and transcripts.
Nucleic Acids Res., 40, W592-W596. [Full Text]