2025-07-15 15:19:14, GGRNA.v2 : RefSeq release 229 (Mar, 2025)
LOCUS XM_018880881 801 bp mRNA linear PLN 07-JAN-2024 DEFINITION Sugiyamaella lignohabitans Bxi1p (BXI1), partial mRNA. ACCESSION XM_018880881 VERSION XM_018880881.1 DBLINK BioProject: PRJNA342695 BioSample: SAMN04417247 KEYWORDS RefSeq. SOURCE Sugiyamaella lignohabitans ORGANISM Sugiyamaella lignohabitans Eukaryota; Fungi; Dikarya; Ascomycota; Saccharomycotina; Dipodascomycetes; Dipodascales; Trichomonascaceae; Sugiyamaella. REFERENCE 1 (bases 1 to 801) AUTHORS Bellasio,M., Peymann,A., Valli,M., Sipitzky,M., Graf,A., Sauer,M., Marx,H. and Mattanovich,D. TITLE Complete genome sequence and transcriptome regulation of the pentose utilising yeast Sugiyamaella lignohabitans JOURNAL Unpublished REFERENCE 2 (bases 1 to 801) CONSRTM NCBI Genome Project TITLE Direct Submission JOURNAL Submitted (04-JAN-2024) National Center for Biotechnology Information, NIH, Bethesda, MD 20894, USA REFERENCE 3 (bases 1 to 801) AUTHORS Peymann,A. and Graf,A. TITLE Direct Submission JOURNAL Submitted (18-FEB-2016) Department of Biotechnology, University of Natural Resources and Life Sciences, Muthgasse 18, Vienna, Vienna 1190, Austria COMMENT PROVISIONAL REFSEQ: This record has not yet been subject to final NCBI review. This record is derived from an annotated genomic sequence (NC_031671). COMPLETENESS: incomplete on both ends. FEATURES Location/Qualifiers source 1..801 /organism="Sugiyamaella lignohabitans" /mol_type="mRNA" /strain="CBS 10342" /type_material="culture from holotype of Candida lignohabitans" /db_xref="taxon:796027" /chromosome="C" gene <1..>801 /gene="BXI1" /locus_tag="AWJ20_3847" /db_xref="GeneID:30035913" CDS 1..801 /gene="BXI1" /locus_tag="AWJ20_3847" /inference="similar to AA sequence:KEGG_Orthology:K06890" /note="Protein involved in apoptosis; variously described as containing a BCL-2 homology (BH3) domain or as a member of the BAX inhibitor family; reported to promote apoptosis under some conditions and to inhibit it in others; localizes to ER and vacuole; may link the unfolded protein response to apoptosis via regulation of calcium-mediated signaling; translocates to mitochondria under apoptosis-inducing conditions in a process involving Mir1p and Cor1p; GO_component: GO:0005783 - endoplasmic reticulum [Evidence IEA]; GO_component: GO:0005783 - endoplasmic reticulum [Evidence IDA] [PMID 21673967]; GO_component: GO:0005789 - endoplasmic reticulum membrane [Evidence IEA]; GO_component: GO:0000324 - fungal-type vacuole [Evidence IDA] [PMID 14562095]; GO_component: GO:0000324 - fungal-type vacuole [Evidence IDA] [PMID 21673659]; GO_component: GO:0000324 - fungal-type vacuole [Evidence IDA] [PMID 21673967]; GO_component: GO:0016021 - integral component of membrane [Evidence IEA]; GO_component: GO:0016021 - integral component of membrane [Evidence ISM] [PMID 12192589]; GO_component: GO:0016020 - membrane [Evidence IEA]; GO_component: GO:0031966 - mitochondrial membrane [Evidence IEA]; GO_component: GO:0005739 - mitochondrion [Evidence IEA]; GO_component: GO:0005739 - mitochondrion [Evidence IDA] [PMID 21673659]; GO_component: GO:0005774 - vacuolar membrane [Evidence IEA]; GO_component: GO:0005773 - vacuole [Evidence IEA]; GO_function: GO:0003674 - molecular_function [Evidence ND]; GO_process: GO:0006915 - apoptotic process [Evidence IEA]; GO_process: GO:0006915 - apoptotic process [Evidence IMP] [PMID 21673659]; GO_process: GO:0006915 - apoptotic process [Evidence IMP] [PMID 21673967]; GO_process: GO:0019722 - calcium-mediated signaling [Evidence IMP] [PMID 21673967]; GO_process: GO:0030968 - endoplasmic reticulum unfolded protein response [Evidence IMP] [PMID 21673967]" /codon_start=1 /product="Bxi1p" /protein_id="XP_018733528.1" /db_xref="GeneID:30035913" /translation="
MSTPSAPPPQYTAPGNGAQSSEPLLVPGEAPPRRQEDDNIPDDFKYSTSVAECTLPIRHAFLRKVYTILFGQLVVTAAVGAVISQNSSVSHWVLTHIWTFYVAIFGAMGLMIGAYVKQRSYPTNMLFLGGFTLLESYCVGIISSLYDTKIVIQAVVLTLVIFGGLSLFALQTKYDFSGWQSYLGAALWGLIGFGLISIFMPYSSGVELAYSVVGALVFAGYIVVDTQLIMRRYHPEDEVAAAIALYLDIINLFLNILRILNEMNRD"
misc_feature 100..792 /gene="BXI1" /locus_tag="AWJ20_3847" /note="Golgi antiapoptotic protein; Region: GAAP_like; cd10429" /db_xref="CDD:198411" ORIGIN
atgtcgacgccatcagccccacctccacaatacacagcacccggaaacggggcgcaaagctcagagccgttgctcgtgccgggagaagcgccacccagacgtcaggaggacgacaacatcccagacgactttaaatactcgacttcagtggccgaatgtactcttcctatccgtcatgcgttcctgagaaaagtttatacaattctgttcggccaactggttgtaacagcggcagttggtgccgtcatttcgcagaactccagtgtatctcactgggttctgacccatatctggaccttttacgttgctattttcggagccatgggtcttatgattggagcctatgtcaaacagagatcatatcccacgaacatgctctttttagggggattcactttgttagagagttactgtgttggcatcatctcctctttgtacgacactaagattgtcattcaagcagtagtattgacattggtcatttttggcgggttgtcattgtttgcacttcaaactaaatacgatttcagcggctggcaatcgtacctcggagctgctttgtggggattgatcgggttcggactcatctccatctttatgccatactcgagcggagtcgagctcgcatacagcgttgtcggagcactggtgtttgctggatacatcgttgtcgacacccagctcatcatgcgacgctaccatcccgaagacgaggtggcagctgccattgctctctacctcgacatcatcaacctcttcctcaacatcctccgaatcctcaacgaaatgaacagagactag
//
by
@meso_cacase at
DBCLS
This page is licensed under a
Creative Commons Attribution 4.0 International License (CC BY 4.0).
If you use GGRNA in your work, please cite:
Naito Y, Bono H. (2012)
GGRNA: an ultrafast, transcript-oriented search engine for genes and transcripts.
Nucleic Acids Res., 40, W592-W596.
[Full Text]