GGRNA ver.2 Home | Help | Advanced search    Previous release (v1)

2025-07-15 15:19:14, GGRNA.v2 : RefSeq release 229 (Mar, 2025)

LOCUS       XM_018880881             801 bp    mRNA    linear   PLN 07-JAN-2024
DEFINITION  Sugiyamaella lignohabitans Bxi1p (BXI1), partial mRNA.
ACCESSION   XM_018880881
VERSION     XM_018880881.1
DBLINK      BioProject: PRJNA342695
            BioSample: SAMN04417247
KEYWORDS    RefSeq.
SOURCE      Sugiyamaella lignohabitans
  ORGANISM  Sugiyamaella lignohabitans
            Eukaryota; Fungi; Dikarya; Ascomycota; Saccharomycotina;
            Dipodascomycetes; Dipodascales; Trichomonascaceae; Sugiyamaella.
REFERENCE   1  (bases 1 to 801)
  AUTHORS   Bellasio,M., Peymann,A., Valli,M., Sipitzky,M., Graf,A., Sauer,M.,
            Marx,H. and Mattanovich,D.
  TITLE     Complete genome sequence and transcriptome regulation of the
            pentose utilising yeast Sugiyamaella lignohabitans
  JOURNAL   Unpublished
REFERENCE   2  (bases 1 to 801)
  CONSRTM   NCBI Genome Project
  TITLE     Direct Submission
  JOURNAL   Submitted (04-JAN-2024) National Center for Biotechnology
            Information, NIH, Bethesda, MD 20894, USA
REFERENCE   3  (bases 1 to 801)
  AUTHORS   Peymann,A. and Graf,A.
  TITLE     Direct Submission
  JOURNAL   Submitted (18-FEB-2016) Department of Biotechnology, University of
            Natural Resources and Life Sciences, Muthgasse 18, Vienna, Vienna
            1190, Austria
COMMENT     PROVISIONAL REFSEQ: This record has not yet been subject to final
            NCBI review. This record is derived from an annotated genomic
            sequence (NC_031671).
            COMPLETENESS: incomplete on both ends.
FEATURES             Location/Qualifiers
     source          1..801
                     /organism="Sugiyamaella lignohabitans"
                     /mol_type="mRNA"
                     /strain="CBS 10342"
                     /type_material="culture from holotype of Candida
                     lignohabitans"
                     /db_xref="taxon:796027"
                     /chromosome="C"
     gene            <1..>801
                     /gene="BXI1"
                     /locus_tag="AWJ20_3847"
                     /db_xref="GeneID:30035913"
     CDS             1..801
                     /gene="BXI1"
                     /locus_tag="AWJ20_3847"
                     /inference="similar to AA sequence:KEGG_Orthology:K06890"
                     /note="Protein involved in apoptosis; variously described
                     as containing a BCL-2 homology (BH3) domain or as a member
                     of the BAX inhibitor family; reported to promote apoptosis
                     under some conditions and to inhibit it in others;
                     localizes to ER and vacuole; may link the unfolded protein
                     response to apoptosis via regulation of calcium-mediated
                     signaling; translocates to mitochondria under
                     apoptosis-inducing conditions in a process involving Mir1p
                     and Cor1p; GO_component: GO:0005783 - endoplasmic
                     reticulum [Evidence IEA]; GO_component: GO:0005783 -
                     endoplasmic reticulum [Evidence IDA] [PMID 21673967];
                     GO_component: GO:0005789 - endoplasmic reticulum membrane
                     [Evidence IEA]; GO_component: GO:0000324 - fungal-type
                     vacuole [Evidence IDA] [PMID 14562095]; GO_component:
                     GO:0000324 - fungal-type vacuole [Evidence IDA] [PMID
                     21673659]; GO_component: GO:0000324 - fungal-type vacuole
                     [Evidence IDA] [PMID 21673967]; GO_component: GO:0016021 -
                     integral component of membrane [Evidence IEA];
                     GO_component: GO:0016021 - integral component of membrane
                     [Evidence ISM] [PMID 12192589]; GO_component: GO:0016020 -
                     membrane [Evidence IEA]; GO_component: GO:0031966 -
                     mitochondrial membrane [Evidence IEA]; GO_component:
                     GO:0005739 - mitochondrion [Evidence IEA]; GO_component:
                     GO:0005739 - mitochondrion [Evidence IDA] [PMID 21673659];
                     GO_component: GO:0005774 - vacuolar membrane [Evidence
                     IEA]; GO_component: GO:0005773 - vacuole [Evidence IEA];
                     GO_function: GO:0003674 - molecular_function [Evidence
                     ND]; GO_process: GO:0006915 - apoptotic process [Evidence
                     IEA]; GO_process: GO:0006915 - apoptotic process [Evidence
                     IMP] [PMID 21673659]; GO_process: GO:0006915 - apoptotic
                     process [Evidence IMP] [PMID 21673967]; GO_process:
                     GO:0019722 - calcium-mediated signaling [Evidence IMP]
                     [PMID 21673967]; GO_process: GO:0030968 - endoplasmic
                     reticulum unfolded protein response [Evidence IMP] [PMID
                     21673967]"
                     /codon_start=1
                     /product="Bxi1p"
                     /protein_id="XP_018733528.1"
                     /db_xref="GeneID:30035913"
                     /translation="
MSTPSAPPPQYTAPGNGAQSSEPLLVPGEAPPRRQEDDNIPDDFKYSTSVAECTLPIRHAFLRKVYTILFGQLVVTAAVGAVISQNSSVSHWVLTHIWTFYVAIFGAMGLMIGAYVKQRSYPTNMLFLGGFTLLESYCVGIISSLYDTKIVIQAVVLTLVIFGGLSLFALQTKYDFSGWQSYLGAALWGLIGFGLISIFMPYSSGVELAYSVVGALVFAGYIVVDTQLIMRRYHPEDEVAAAIALYLDIINLFLNILRILNEMNRD"
     misc_feature    100..792
                     /gene="BXI1"
                     /locus_tag="AWJ20_3847"
                     /note="Golgi antiapoptotic protein; Region: GAAP_like;
                     cd10429"
                     /db_xref="CDD:198411"
ORIGIN      
atgtcgacgccatcagccccacctccacaatacacagcacccggaaacggggcgcaaagctcagagccgttgctcgtgccgggagaagcgccacccagacgtcaggaggacgacaacatcccagacgactttaaatactcgacttcagtggccgaatgtactcttcctatccgtcatgcgttcctgagaaaagtttatacaattctgttcggccaactggttgtaacagcggcagttggtgccgtcatttcgcagaactccagtgtatctcactgggttctgacccatatctggaccttttacgttgctattttcggagccatgggtcttatgattggagcctatgtcaaacagagatcatatcccacgaacatgctctttttagggggattcactttgttagagagttactgtgttggcatcatctcctctttgtacgacactaagattgtcattcaagcagtagtattgacattggtcatttttggcgggttgtcattgtttgcacttcaaactaaatacgatttcagcggctggcaatcgtacctcggagctgctttgtggggattgatcgggttcggactcatctccatctttatgccatactcgagcggagtcgagctcgcatacagcgttgtcggagcactggtgtttgctggatacatcgttgtcgacacccagctcatcatgcgacgctaccatcccgaagacgaggtggcagctgccattgctctctacctcgacatcatcaacctcttcctcaacatcctccgaatcctcaacgaaatgaacagagactag
//

by @meso_cacase at DBCLS
This page is licensed under a Creative Commons Attribution 4.0 International License (CC BY 4.0).

If you use GGRNA in your work, please cite:
Naito Y, Bono H. (2012)
GGRNA: an ultrafast, transcript-oriented search engine for genes and transcripts.
Nucleic Acids Res., 40, W592-W596. [Full Text]