GGRNA ver.2 Home | Help | Advanced search    Previous release (v1)

2025-06-07 19:23:08, GGRNA.v2 : RefSeq release 229 (Mar, 2025)

LOCUS       XM_018880768            1020 bp    mRNA    linear   PLN 07-JAN-2024
DEFINITION  Sugiyamaella lignohabitans Thi73p (THI73), partial mRNA.
ACCESSION   XM_018880768
VERSION     XM_018880768.1
DBLINK      BioProject: PRJNA342695
            BioSample: SAMN04417247
KEYWORDS    RefSeq.
SOURCE      Sugiyamaella lignohabitans
  ORGANISM  Sugiyamaella lignohabitans
            Eukaryota; Fungi; Dikarya; Ascomycota; Saccharomycotina;
            Dipodascomycetes; Dipodascales; Trichomonascaceae; Sugiyamaella.
REFERENCE   1  (bases 1 to 1020)
  AUTHORS   Bellasio,M., Peymann,A., Valli,M., Sipitzky,M., Graf,A., Sauer,M.,
            Marx,H. and Mattanovich,D.
  TITLE     Complete genome sequence and transcriptome regulation of the
            pentose utilising yeast Sugiyamaella lignohabitans
  JOURNAL   Unpublished
REFERENCE   2  (bases 1 to 1020)
  CONSRTM   NCBI Genome Project
  TITLE     Direct Submission
  JOURNAL   Submitted (04-JAN-2024) National Center for Biotechnology
            Information, NIH, Bethesda, MD 20894, USA
REFERENCE   3  (bases 1 to 1020)
  AUTHORS   Peymann,A. and Graf,A.
  TITLE     Direct Submission
  JOURNAL   Submitted (18-FEB-2016) Department of Biotechnology, University of
            Natural Resources and Life Sciences, Muthgasse 18, Vienna, Vienna
            1190, Austria
COMMENT     PROVISIONAL REFSEQ: This record has not yet been subject to final
            NCBI review. This record is derived from an annotated genomic
            sequence (NC_031671).
            COMPLETENESS: incomplete on both ends.
FEATURES             Location/Qualifiers
     source          1..1020
                     /organism="Sugiyamaella lignohabitans"
                     /mol_type="mRNA"
                     /strain="CBS 10342"
                     /type_material="culture from holotype of Candida
                     lignohabitans"
                     /db_xref="taxon:796027"
                     /chromosome="C"
     gene            <1..>1020
                     /gene="THI73"
                     /locus_tag="AWJ20_3742"
                     /db_xref="GeneID:30035797"
     CDS             1..1020
                     /gene="THI73"
                     /locus_tag="AWJ20_3742"
                     /note="Putative plasma membrane permease; proposed to be
                     involved in carboxylic acid uptake and repressed by
                     thiamine; substrate of Dbf2p/Mob1p kinase; transcription
                     is altered if mitochondrial dysfunction occurs;
                     GO_component: GO:0005783 - endoplasmic reticulum [Evidence
                     IEA]; GO_component: GO:0005783 - endoplasmic reticulum
                     [Evidence IDA] [PMID 16850348]; GO_component: GO:0005789 -
                     endoplasmic reticulum membrane [Evidence IEA];
                     GO_component: GO:0016021 - integral component of membrane
                     [Evidence IEA,IEA]; GO_component: GO:0016021 - integral
                     component of membrane [Evidence ISS] [PMID 10869563];
                     GO_component: GO:0016021 - integral component of membrane
                     [Evidence ISM] [PMID 12192589]; GO_component: GO:0016020 -
                     membrane [Evidence IEA]; GO_component: GO:0005886 - plasma
                     membrane [Evidence IEA,IEA]; GO_function: GO:0005215 -
                     transporter activity [Evidence ISS] [PMID 10869563];
                     GO_process: GO:0055085 - transmembrane transport [Evidence
                     IEA]; GO_process: GO:0006810 - transport [Evidence IEA];
                     GO_process: GO:0006810 - transport [Evidence ISS] [PMID
                     10869563]"
                     /codon_start=1
                     /product="Thi73p"
                     /protein_id="XP_018733425.1"
                     /db_xref="GeneID:30035797"
                     /translation="
MWYKKAEQGKRIGAFYVMNSVTLIAAGIISYAASFAKTAFASWRIFLLCMGLVTVFCGICVFLFLPDSIVRSKGFTDEEKVAALLRVKDEQSGTQNSKLKRYQMVEAVSDPKVWFVVLSVFLFSIPNGAITVFNSIIINSYGFGSQETLIVGAPAGVVTGAAVIIIQYYSDKTQNRTLISIWYFIPSIVGLAIMIALGDREKTLSMKAGLLIASYLSQVFGGGLALFLSWNASNIAGHSKKALVNALTFIAFPLGNILGTQTFQNKDAPMYIPGKISIMACLCAQVVVSTVWFFVNKYYNKKKQTFLDTLNVYEYEGLRMKMEFSDETDMRNPFFKYTK"
     misc_feature    <1..867
                     /gene="THI73"
                     /locus_tag="AWJ20_3742"
                     /note="Major Facilitator Superfamily; Region: MFS;
                     cl28910"
                     /db_xref="CDD:475125"
ORIGIN      
atgtggtacaagaaagcagaacaaggaaagagaattggtgccttttatgtaatgaacagtgtcacactcatcgctgctggaatcatatcttatgctgcttcatttgcaaagactgcctttgcatcttggagaatctttcttctttgtatggggcttgttacagttttctgtggtatatgtgtatttctgttcctacctgattccattgtaagaagcaaaggatttacggacgaagaaaaagttgctgctctccttcgagtcaaggatgaacagagtggaactcagaatagcaagctgaaacgatatcaaatggttgaggctgtcagcgaccctaaagtatggtttgttgtcctttctgtttttctcttttcaattccaaatggagccatcactgtatttaattctataattatcaatagttacggcttcggctcccaagaaactttgattgttggagcacctgctggtgtggtgacgggagccgctgttatcattatccagtactactcagacaaaactcaaaacaggacactcatcagcatttggtattttattccctctattgttggtctagcaatcatgattgctcttggtgatcgagaaaagactcttagtatgaaagctgggctattgatagccagctacttgtctcaagtttttggtggcggattggcactgtttttatcgtggaatgcctctaatattgcaggacattcgaagaaagctttagtcaacgcattaacgtttattgcatttcctctgggaaacatcttgggaacgcaaactttccaaaataaagatgccccaatgtatattcctggaaaaatcagtataatggcatgtctctgtgctcaggtggttgtttcaacagtttggttcttcgtcaataagtactacaataaaaagaaacaaacatttttagataccttgaatgtatatgagtacgagggtctacgtatgaaaatggagttctccgatgaaactgatatgagaaatccctttttcaagtatactaaatag
//

by @meso_cacase at DBCLS
This page is licensed under a Creative Commons Attribution 4.0 International License (CC BY 4.0).

If you use GGRNA in your work, please cite:
Naito Y, Bono H. (2012)
GGRNA: an ultrafast, transcript-oriented search engine for genes and transcripts.
Nucleic Acids Res., 40, W592-W596. [Full Text]