2025-06-07 19:21:52, GGRNA.v2 : RefSeq release 229 (Mar, 2025)
LOCUS XM_018878834 501 bp mRNA linear PLN 07-JAN-2024 DEFINITION Sugiyamaella lignohabitans Emp24p (EMP24), partial mRNA. ACCESSION XM_018878834 VERSION XM_018878834.1 DBLINK BioProject: PRJNA342695 BioSample: SAMN04417247 KEYWORDS RefSeq. SOURCE Sugiyamaella lignohabitans ORGANISM Sugiyamaella lignohabitans Eukaryota; Fungi; Dikarya; Ascomycota; Saccharomycotina; Dipodascomycetes; Dipodascales; Trichomonascaceae; Sugiyamaella. REFERENCE 1 (bases 1 to 501) AUTHORS Bellasio,M., Peymann,A., Valli,M., Sipitzky,M., Graf,A., Sauer,M., Marx,H. and Mattanovich,D. TITLE Complete genome sequence and transcriptome regulation of the pentose utilising yeast Sugiyamaella lignohabitans JOURNAL Unpublished REFERENCE 2 (bases 1 to 501) CONSRTM NCBI Genome Project TITLE Direct Submission JOURNAL Submitted (04-JAN-2024) National Center for Biotechnology Information, NIH, Bethesda, MD 20894, USA REFERENCE 3 (bases 1 to 501) AUTHORS Peymann,A. and Graf,A. TITLE Direct Submission JOURNAL Submitted (18-FEB-2016) Department of Biotechnology, University of Natural Resources and Life Sciences, Muthgasse 18, Vienna, Vienna 1190, Austria COMMENT PROVISIONAL REFSEQ: This record has not yet been subject to final NCBI review. This record is derived from an annotated genomic sequence (NC_031672). COMPLETENESS: incomplete on both ends. FEATURES Location/Qualifiers source 1..501 /organism="Sugiyamaella lignohabitans" /mol_type="mRNA" /strain="CBS 10342" /type_material="culture from holotype of Candida lignohabitans" /db_xref="taxon:796027" /chromosome="A" gene <1..>501 /gene="EMP24" /locus_tag="AWJ20_192" /db_xref="GeneID:30033774" CDS 1..501 /gene="EMP24" /locus_tag="AWJ20_192" /note="Component of the p24 complex; role in misfolded protein quality control; binds to GPI anchor proteins and mediates their efficient transport from the ER to the Golgi; integral membrane protein that associates with endoplasmic reticulum-derived COPII-coated vesicles; GO_component: GO:0030134 - ER to Golgi transport vesicle [Evidence IDA] [PMID 11157978]; GO_component: GO:0005794 - Golgi apparatus [Evidence IEA]; GO_component: GO:0000139 - Golgi membrane [Evidence IEA]; GO_component: GO:0005783 - endoplasmic reticulum [Evidence IEA]; GO_component: GO:0005783 - endoplasmic reticulum [Evidence IDA] [PMID 8862519]; GO_component: GO:0005789 - endoplasmic reticulum membrane [Evidence IEA]; GO_component: GO:0016021 - integral component of membrane [Evidence IEA,IEA]; GO_component: GO:0016021 - integral component of membrane [Evidence ISS] [PMID 8862519]; GO_component: GO:0016020 - membrane [Evidence IEA]; GO_function: GO:0003674 - molecular_function [Evidence ND]; GO_process: GO:0006888 - ER to Golgi vesicle-mediated transport [Evidence IPI] [PMID 11157978]; GO_process: GO:0006888 - ER to Golgi vesicle-mediated transport [Evidence IMP] [PMID 8862519]; GO_process: GO:0006621 - protein retention in ER lumen [Evidence IMP] [PMID 8862519]; GO_process: GO:0015031 - protein transport [Evidence IEA]; GO_process: GO:0006810 - transport [Evidence IEA,IEA]; GO_process: GO:0016050 - vesicle organization [Evidence IGI,IMP] [PMID 8862519]; GO_process: GO:0016192 - vesicle-mediated transport [Evidence IEA]" /codon_start=1 /product="Emp24p" /protein_id="XP_018734442.1" /db_xref="GeneID:30033774" /translation="
MRKGDQLAISFQVGDRDPSSSNQLEVDFWITDPHKNQIRSLHRVADGDASVEITESGRYEYCFSNEFSHVGTKDVTFHIHGIVYVDNDNPSPDSLDSQVKILSRLVQEVKNEQGYLVIRERTHRNTAESTNSRVKWWSLFQIIVVAVNSLFQIYYLKRFFEVKTNV"
misc_feature 1..483 /gene="EMP24" /locus_tag="AWJ20_192" /note="emp24/gp25L/p24 family/GOLD; Region: EMP24_GP25L; pfam01105" /db_xref="CDD:426051" ORIGIN
atgcgaaagggcgaccagctggccatttcgttccaggtcggtgaccgagacccttcgtcgtcgaatcaattggaggttgatttctggatcactgatccccacaaaaaccagatccggtctcttcacagagtggctgatggagatgcttcagtcgagatcactgaaagtggtcgctacgagtactgtttctccaacgagttctctcacgttggcaccaaagacgtcacattccacatccacggcattgtctatgtagacaacgacaacccatcaccagactcactcgacagccaagtcaagatcctcagtcgtcttgttcaagaagtcaagaacgagcaaggctacctcgtgatccgcgagcgaacccaccgtaacacagccgaatccaccaactcgcgtgtcaagtggtggagtctgttccaaatcattgtcgtcgccgtcaacagtctgttccagatctactacctcaagcggttttttgaggtcaagaccaatgtataa
//
by
@meso_cacase at
DBCLS
This page is licensed under a
Creative Commons Attribution 4.0 International License (CC BY 4.0).
If you use GGRNA in your work, please cite:
Naito Y, Bono H. (2012)
GGRNA: an ultrafast, transcript-oriented search engine for genes and transcripts.
Nucleic Acids Res., 40, W592-W596.
[Full Text]