2025-07-15 15:18:12, GGRNA.v2 : RefSeq release 229 (Mar, 2025)
LOCUS XM_018877915 609 bp mRNA linear PLN 07-JAN-2024 DEFINITION Sugiyamaella lignohabitans Lot6p (LOT6), partial mRNA. ACCESSION XM_018877915 VERSION XM_018877915.1 DBLINK BioProject: PRJNA342695 BioSample: SAMN04417247 KEYWORDS RefSeq. SOURCE Sugiyamaella lignohabitans ORGANISM Sugiyamaella lignohabitans Eukaryota; Fungi; Dikarya; Ascomycota; Saccharomycotina; Dipodascomycetes; Dipodascales; Trichomonascaceae; Sugiyamaella. REFERENCE 1 (bases 1 to 609) AUTHORS Bellasio,M., Peymann,A., Valli,M., Sipitzky,M., Graf,A., Sauer,M., Marx,H. and Mattanovich,D. TITLE Complete genome sequence and transcriptome regulation of the pentose utilising yeast Sugiyamaella lignohabitans JOURNAL Unpublished REFERENCE 2 (bases 1 to 609) CONSRTM NCBI Genome Project TITLE Direct Submission JOURNAL Submitted (04-JAN-2024) National Center for Biotechnology Information, NIH, Bethesda, MD 20894, USA REFERENCE 3 (bases 1 to 609) AUTHORS Peymann,A. and Graf,A. TITLE Direct Submission JOURNAL Submitted (18-FEB-2016) Department of Biotechnology, University of Natural Resources and Life Sciences, Muthgasse 18, Vienna, Vienna 1190, Austria COMMENT PROVISIONAL REFSEQ: This record has not yet been subject to final NCBI review. This record is derived from an annotated genomic sequence (NC_031672). COMPLETENESS: incomplete on both ends. FEATURES Location/Qualifiers source 1..609 /organism="Sugiyamaella lignohabitans" /mol_type="mRNA" /strain="CBS 10342" /type_material="culture from holotype of Candida lignohabitans" /db_xref="taxon:796027" /chromosome="A" gene <1..>609 /gene="LOT6" /locus_tag="AWJ20_1065" /db_xref="GeneID:30032826" CDS 1..609 /gene="LOT6" /locus_tag="AWJ20_1065" /note="FMN-dependent NAD(P)H:quinone reductase; role in apoptosis-like cell death; may be involved in quinone detoxification; expression elevated at low temperature; sequesters the Cin5p transcription factor in the cytoplasm in complex with the proteasome under reducing conditions; GO_component: GO:0005737 - cytoplasm [Evidence IEA,IEA]; GO_component: GO:0005737 - cytoplasm [Evidence IDA] [PMID 14562095]; GO_component: GO:0005829 - cytosol [Evidence IDA] [PMID 17298444]; GO_component: GO:0005634 - nucleus [Evidence IEA,IEA]; GO_component: GO:0005634 - nucleus [Evidence IDA] [PMID 14562095]; GO_component: GO:0005634 - nucleus [Evidence IDA] [PMID 17298444]; GO_function: GO:0052874 - FMN reductase (NADH) activity [Evidence IEA]; GO_function: GO:0052873 - FMN reductase (NADPH) activity [Evidence IEA]; GO_function: GO:0003955 - NAD(P)H dehydrogenase (quinone) activity [Evidence IDA,IMP] [PMID 17298444]; GO_function: GO:0016491 - oxidoreductase activity [Evidence IEA,IEA]; GO_function: GO:0008134 - transcription factor binding [Evidence IDA] [PMID 19029946]; GO_process: GO:0006915 - apoptotic process [Evidence IMP] [PMID 19709309]; GO_process: GO:0034599 - cellular response to oxidative stress [Evidence IMP] [PMID 17298444]; GO_process: GO:0042994 - cytoplasmic sequestering of transcription factor [Evidence IDA] [PMID 19029946]; GO_process: GO:0055114 - oxidation-reduction process [Evidence IEA]" /codon_start=1 /product="Lot6p" /protein_id="XP_018735270.1" /db_xref="GeneID:30032826" /translation="
MTGSISSVKRVAVISGSARKNRVNPHVAEYVRQRSAEFATKNITFELVDVGEQKLPLYDEPKIPSTLPSDNPTPHYEYEHSRAWSSVVSKFDAFIFVTPQYNWSIPASLKNAIDYLFYEWAGKPAGIVSYGGHGGVRAADHLRQILTGIKIRVVPSAVALNIDRNTMQLLTLREEQLQAWKDASVDDSIKKLVEELSAELSS"
misc_feature 25..483 /gene="LOT6" /locus_tag="AWJ20_1065" /note="NAD(P)H-dependent FMN reductase [Energy production and conversion]; Region: SsuE; COG0431" /db_xref="CDD:440200" ORIGIN
atgactggtagtattagtagcgttaagagagtggctgttatcagtggcagtgcccgaaagaacagagtcaatccccatgtcgctgagtacgtgagacagagatctgccgaattcgccactaagaacatcactttcgagcttgtcgatgtaggagaacagaaactgcctctttatgatgaacccaagattccttcgactctgccatcagataatcctactcctcattacgaatatgagcacagtagagcctggtcatctgtagtgagcaaattcgatgcttttatatttgttactcctcagtataattggagtatccccgcatccttgaaaaatgcaattgactacctcttctatgaatgggcaggaaagcctgcaggtattgtcagttatggtggtcatggtggcgtgcgagctgctgaccatttacgccaaattcttaccggaatcaaaataagagtcgttccgagtgctgtagctctcaatattgacagaaacactatgcagctgctcactcttcgtgaagaacaactccaagcgtggaaagatgctagtgtagatgattctatcaaaaagcttgttgaggaactatcggctgagctcagttcatga
//
by
@meso_cacase at
DBCLS
This page is licensed under a
Creative Commons Attribution 4.0 International License (CC BY 4.0).
If you use GGRNA in your work, please cite:
Naito Y, Bono H. (2012)
GGRNA: an ultrafast, transcript-oriented search engine for genes and transcripts.
Nucleic Acids Res., 40, W592-W596.
[Full Text]