2024-04-27 08:48:49, GGRNA.v2 : RefSeq release 222 (Jan, 2024)
LOCUS XM_018709905 772 bp mRNA linear INV 10-JAN-2018 DEFINITION PREDICTED: Anoplophora glabripennis transcription factor MafK (LOC108906600), mRNA. ACCESSION XM_018709905 VERSION XM_018709905.1 DBLINK BioProject: PRJNA348318 KEYWORDS RefSeq. SOURCE Anoplophora glabripennis (Asian longhorned beetle) ORGANISM Anoplophora glabripennis Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta; Pterygota; Neoptera; Endopterygota; Coleoptera; Polyphaga; Cucujiformia; Chrysomeloidea; Cerambycidae; Lamiinae; Lamiini; Anoplophora. COMMENT MODEL REFSEQ: This record is predicted by automated computational analysis. This record is derived from a genomic sequence (NW_019416472.1) annotated using gene prediction method: Gnomon. Also see: Documentation of NCBI's Annotation Process ##Genome-Annotation-Data-START## Annotation Provider :: NCBI Annotation Status :: Full annotation Annotation Name :: Anoplophora glabripennis Annotation Release 101 Annotation Version :: 101 Annotation Pipeline :: NCBI eukaryotic genome annotation pipeline Annotation Software Version :: 8.0 Annotation Method :: Best-placed RefSeq; Gnomon Features Annotated :: Gene; mRNA; CDS; ncRNA ##Genome-Annotation-Data-END## FEATURES Location/Qualifiers source 1..772 /organism="Anoplophora glabripennis" /mol_type="mRNA" /isolate="ALB-LARVAE" /isolation_source="'mixed' research colony (originating from wild-collected US specimens from several localities)" /db_xref="taxon:217634" /chromosome="Unknown" /country="USA: Otis Air National Guard Base, MA" /collection_date="Aug-2011" gene 1..772 /gene="LOC108906600" /note="Derived by automated computational analysis using gene prediction method: Gnomon. Supporting evidence includes similarity to: 12 Proteins, and 100% coverage of the annotated genomic feature by RNAseq alignments, including 13 samples with support for all annotated introns" /db_xref="GeneID:108906600" CDS 157..555 /gene="LOC108906600" /codon_start=1 /product="transcription factor MafK" /protein_id="XP_018565421.1" /db_xref="GeneID:108906600" /translation="
MPQESKKNAKLAPLSPSPLLDISDDELVSISVRDLNRQLKLRGLSRDEIVRMKQRRRTLKNRGYAASCRIKRIEQKDELETEKTQEWRDLEVMKDELIHMREEMSGMTSRYEALKQFAISNKIPIPPDLEHF"
misc_feature 292..498 /gene="LOC108906600" /note="Basic leucine zipper (bZIP) domain of small musculoaponeurotic fibrosarcoma (Maf) proteins: a DNA-binding and dimerization domain; Region: bZIP_Maf_small; cd14717" /db_xref="CDD:269865" misc_feature 292..498 /gene="LOC108906600" /note="coiled coil [structural motif]; Region: coiled coil" /db_xref="CDD:269865" misc_feature order(322..330,334..342,346..351,358..363,367..372) /gene="LOC108906600" /note="DNA binding site [nucleotide binding]" /db_xref="CDD:269865" misc_feature order(370..372,379..384,391..396,400..405,412..417, 421..426,433..435,442..447,454..456,463..468,475..480) /gene="LOC108906600" /note="dimer interface [polypeptide binding]; other site" /db_xref="CDD:269865" ORIGIN
ttttgtgcaatcaaaacatagttcatggcgttttatctttctacgttctatatttcttagcatgacttgcacaaactcatcaaaaggtgcagcagatgtaaaatatttaaagaactatcttcaaaatataacgtgaagtaattctaaaaattcaacatgcctcaagaatctaaaaagaatgcgaaacttgctcccttatcgccatcgcctttgctggatatatctgatgatgaattggtgagtatctcggtgcgagatttaaacaggcaattaaagttgagaggattgtccagagatgagattgttcgaatgaaacaaagaagacgaacattgaagaatagaggatatgctgcatcttgtcgaattaaaagaattgaacaaaaagatgaactagaaactgagaaaacacaagagtggagagatttggaagttatgaaggacgaacttattcacatgagggaagaaatgtctggaatgactagtcgttatgaagcactgaagcaatttgctattagcaataaaattcccattccaccagacctagaacatttttaacatttgatttatatcacatgagaaatgtttagctttattataatgactcgagacaaaagtaaagaatagctttttagagaatactattaaagtattaatatacattttttatatatcttgaaattacaatgtgaatttcaaaatgtatattcataaaatactataattccagcagtttgaacggatatgtggagtaataaaagtagttgaaaaactt
//
by
@meso_cacase at
DBCLS
This page is licensed under a
Creative Commons Attribution 4.0 International License (CC BY 4.0).
If you use GGRNA in your work, please cite:
Naito Y, Bono H. (2012)
GGRNA: an ultrafast, transcript-oriented search engine for genes and transcripts.
Nucleic Acids Res., 40, W592-W596.
[Full Text]