2024-04-19 14:49:46, GGRNA.v2 : RefSeq release 222 (Jan, 2024)
LOCUS XM_018120908 507 bp mRNA linear PLN 12-SEP-2016 DEFINITION PREDICTED: Theobroma cacao uncharacterized LOC108661919 (LOC108661919), mRNA. ACCESSION XM_018120908 VERSION XM_018120908.1 DBLINK BioProject: PRJNA341501 KEYWORDS RefSeq; includes ab initio. SOURCE Theobroma cacao (cacao) ORGANISM Theobroma cacao Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta; Spermatophyta; Magnoliopsida; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Malvales; Malvaceae; Byttnerioideae; Theobroma. COMMENT MODEL REFSEQ: This record is predicted by automated computational analysis. This record is derived from a genomic sequence (NC_030854.1) annotated using gene prediction method: Gnomon. Also see: Documentation of NCBI's Annotation Process ##Genome-Annotation-Data-START## Annotation Provider :: NCBI Annotation Status :: Full annotation Annotation Version :: Theobroma cacao Annotation Release 100 Annotation Pipeline :: NCBI eukaryotic genome annotation pipeline Annotation Software Version :: 7.1 Annotation Method :: Best-placed RefSeq; Gnomon Features Annotated :: Gene; mRNA; CDS; ncRNA ##Genome-Annotation-Data-END## ##RefSeq-Attributes-START## ab initio :: 100% of CDS bases ##RefSeq-Attributes-END## FEATURES Location/Qualifiers source 1..507 /organism="Theobroma cacao" /mol_type="mRNA" /cultivar="B97-61/B2" /db_xref="taxon:3641" /chromosome="5" gene 1..507 /gene="LOC108661919" /note="Derived by automated computational analysis using gene prediction method: Gnomon. Supporting evidence includes similarity to: 1 Protein" /db_xref="GeneID:108661919" CDS 1..507 /gene="LOC108661919" /codon_start=1 /product="uncharacterized protein LOC108661919" /protein_id="XP_017976397.1" /db_xref="GeneID:108661919" /translation="
MANNLSLRSILDANTLTGPNFFDLFRNLKIVLKQKKKSYVLNIPIPPVPVANVNVEDKEAYQRHKDDDDQAACVMLTSMTPELQKQYEHMDVQSIILHLRKLFDKEWRIERYEISKELFRCKMVEMSFLRPHVPKMIGLIERLRQLGLAMDHGLSIDLILQSLLDSFS"
misc_feature 193..>504 /gene="LOC108661919" /note="gag-polypeptide of LTR copia-type; Region: Retrotran_gag_2; pfam14223" /db_xref="CDD:433786" ORIGIN
atggctaataatctgtcactgcggagcatcttggatgcaaatactctcactggcccaaacttctttgatttgtttcggaacctcaagatcgtcttgaaacagaagaagaaatcctatgtccttaacattcctattccaccagtccctgttgctaatgttaatgttgaggataaggaagcatatcaacgtcataaggatgacgatgatcaggcagcatgcgtgatgctaaccagtatgactcctgagctccaaaagcagtatgagcacatggatgtccaatccataattcttcatcttagaaaattgttcgataaggaatggcgcattgagagatatgagatctctaaagaactattccgatgcaagatggtagaaatgagttttcttagaccccatgtgccgaagatgattggactcatcgagagacttagacaattgggattagcaatggatcatgggctaagtatagacttaattctacaatctcttcttgacagcttcagttag
//
by
@meso_cacase at
DBCLS
This page is licensed under a
Creative Commons Attribution 4.0 International License (CC BY 4.0).
If you use GGRNA in your work, please cite:
Naito Y, Bono H. (2012)
GGRNA: an ultrafast, transcript-oriented search engine for genes and transcripts.
Nucleic Acids Res., 40, W592-W596.
[Full Text]