ver.2
Home
|
Help
|
Advanced search
Previous release (v1)
2025-12-09 09:59:35, GGRNA.v2 : RefSeq release 232 (Sep, 2025)
LOCUS XM_017837100 1397 bp mRNA linear VRT 11-AUG-2016
DEFINITION PREDICTED: Lepidothrix coronata homeobox B8 (HOXB8), transcript
variant X1, mRNA.
ACCESSION XM_017837100
VERSION XM_017837100.1
DBLINK BioProject: PRJNA338288
KEYWORDS RefSeq.
SOURCE Lepidothrix coronata (blue-crowned manakin)
ORGANISM Lepidothrix coronata
Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
Archelosauria; Archosauria; Dinosauria; Saurischia; Theropoda;
Coelurosauria; Aves; Neognathae; Neoaves; Telluraves; Australaves;
Passeriformes; Pipridae; Lepidothrix.
COMMENT MODEL REFSEQ: This record is predicted by automated computational
analysis. This record is derived from a genomic sequence
(NW_016690471.1) annotated using gene prediction method: Gnomon,
supported by EST evidence.
Also see:
Documentation of NCBI's Annotation Process
##Genome-Annotation-Data-START##
Annotation Provider :: NCBI
Annotation Status :: Full annotation
Annotation Version :: Lepidothrix coronata Annotation
Release 100
Annotation Pipeline :: NCBI eukaryotic genome annotation
pipeline
Annotation Software Version :: 7.1
Annotation Method :: Best-placed RefSeq; Gnomon
Features Annotated :: Gene; mRNA; CDS; ncRNA
##Genome-Annotation-Data-END##
FEATURES Location/Qualifiers
source 1..1397
/organism="Lepidothrix coronata"
/mol_type="mRNA"
/isolate="B3197"
/specimen_voucher="LSUMZ:110521"
/db_xref="taxon:321398"
/chromosome="Unknown"
/sex="male"
/dev_stage="adult"
/geo_loc_name="Peru: Loreto Department, 1.5 km S Libertad,
S. bank Rio Napo, 80 km N Iquitos"
gene 1..1397
/gene="HOXB8"
/note="Derived by automated computational analysis using
gene prediction method: Gnomon. Supporting evidence
includes similarity to: 1 EST, 13 Proteins, and 100%
coverage of the annotated genomic feature by RNAseq
alignments, including 1 sample with support for all
annotated introns"
/db_xref="GeneID:108508358"
CDS 45..773
/gene="HOXB8"
/codon_start=1
/product="homeobox protein Hox-B8 isoform X1"
/protein_id="XP_017692589.1"
/db_xref="GeneID:108508358"
/translation="
MSSYFVNSLFSKYKTGDSLRPNYYDCGFAQDLGGRPTVVYGPSTGGTFQHPTQIQEFYHGASSLSSSPYQQNPCAVACHGDPGNFYGYDPLQRQSLFSAQESDLVQYTDCKLAASGLGEEAESSEQSPSPTQLFPWMRPQAAAGRRRGRQTYSRYQTLELEKEFLFNPYLTRKRRIEVSHALGLTERQVKIWFQNRRMKWKKENNKDKFPSSKCEQEELEKQKMERAQEVDEEGEAQKADKK"
misc_feature 480..650
/gene="HOXB8"
/note="Region: Homeodomain; pfam00046"
/db_xref="CDD:459649"
ORIGIN
cttccttcctcctccaaacccgaccgtctcttatttaaattaaaatgagctcttatttcgtcaactcactcttctccaagtacaaaaccggggactccctgcgccccaactactatgactgtgggttcgctcaggatctcgggggcagacccaccgtggtgtacggccccagcacggggggcaccttccagcaccccacccaaatccaggagttctaccacggagcgtcctcgctctccagctccccttaccaacagaatccctgcgccgtggcgtgccatggggaccccggcaacttctatggctacgaccccttgcaaaggcagagcctcttcagcgcccaggagtcggacttggtgcagtacacggactgcaagctcgcggccagcggcctcggggaggaggcggagagctccgagcaaagcccttctccgacccagcttttcccttggatgcgaccgcaagcagccgctggacggaggagggggaggcaaacctacagccgctaccagacgctggaactggagaaggaatttctatttaatccctacctgacccgcaaacggaggatcgaggtctcgcatgccctgggattgacagaaaggcaggtcaaaatctggttccagaacaggaggatgaaatggaaaaaggaaaacaacaaagacaagtttcccagcagcaaatgcgagcaggaagaactggaaaaacagaaaatggaaagagcccaggaggtggacgaggaaggggaagcacagaaggcggacaagaaataaaaggatttttaaggactgaaaggcaagcgctgctggggtggcagagcccccgagccccacgttaatggcagttaatgtaagggaggggtggggaaaaaaaaacaacaatgcatagaaaagagaaaggaaaaaaaaacccttttattgctgtaaaacaatatagctgtaagcaccactttcctgattatcctttgatacaatgaacagtatgcaaaagtgatcgggagctctctcctgccttttgccagttattaactagtggtagtgtaacgcaatagcttatgtaaaacatgactgtgaaatcttctctctctctctctctgtccttctctctgtctctctctcttctttcctggggggtgggttggttaacgtagctttcaatgctagaggagttacgtgaaattacgttcgtgcactttttttttttttttgaaatttgatttttcttttccttttccacctttttggttgtggtttatctgtatgtgccggaggtagctactgaaacaaacatcccaacaacatgaaactgcctatttatgctctagttatctctctctttctctctctcttcctctctttgctttccctgctgttcttttccttggttcggtctttttt
//
by
@meso_cacase at
DBCLS
This page is licensed under a
Creative Commons Attribution 4.0 International License (CC BY 4.0).
If you use GGRNA in your work, please cite:
Naito Y, Bono H. (2012)
GGRNA: an ultrafast, transcript-oriented search engine for genes and transcripts.
Nucleic Acids Res., 40, W592-W596.
[Full Text]