GGRNA ver.2 Home | Help | Advanced search    Previous release (v1)

2025-12-08 04:08:08, GGRNA.v2 : RefSeq release 232 (Sep, 2025)

LOCUS       XM_017102272             411 bp    mRNA    linear   INV 07-OCT-2022
DEFINITION  PREDICTED: Drosophila biarmipes uncharacterized LOC108029766
            (LOC108029766), mRNA.
ACCESSION   XM_017102272
VERSION     XM_017102272.3
DBLINK      BioProject: PRJNA325502
KEYWORDS    RefSeq.
SOURCE      Drosophila biarmipes
  ORGANISM  Drosophila biarmipes
            Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta;
            Pterygota; Neoptera; Endopterygota; Diptera; Brachycera;
            Muscomorpha; Ephydroidea; Drosophilidae; Drosophila; Sophophora.
COMMENT     MODEL REFSEQ:  This record is predicted by automated computational
            analysis. This record is derived from a genomic sequence
            (NC_066615) annotated using gene prediction method: Gnomon.
            Also see:
                Documentation of NCBI's Annotation Process
            
            On Oct 3, 2022 this sequence version replaced XM_017102272.2.
            
            ##Genome-Annotation-Data-START##
            Annotation Provider         :: NCBI RefSeq
            Annotation Status           :: Full annotation
            Annotation Name             :: Drosophila biarmipes Annotation
                                           Release 103
            Annotation Version          :: 103
            Annotation Pipeline         :: NCBI eukaryotic genome annotation
                                           pipeline
            Annotation Software Version :: 10.0
            Annotation Method           :: Best-placed RefSeq; Gnomon
            Features Annotated          :: Gene; mRNA; CDS; ncRNA
            ##Genome-Annotation-Data-END##
FEATURES             Location/Qualifiers
     source          1..411
                     /organism="Drosophila biarmipes"
                     /mol_type="mRNA"
                     /strain="raj3"
                     /db_xref="taxon:125945"
                     /chromosome="2R"
                     /sex="female"
                     /tissue_type="whole-body"
                     /dev_stage="adult"
     gene            1..411
                     /gene="LOC108029766"
                     /note="uncharacterized LOC108029766; Derived by automated
                     computational analysis using gene prediction method:
                     Gnomon. Supporting evidence includes similarity to: 1
                     Protein"
                     /db_xref="GeneID:108029766"
     CDS             94..411
                     /gene="LOC108029766"
                     /codon_start=1
                     /product="uncharacterized protein LOC108029766"
                     /protein_id="XP_016957761.1"
                     /db_xref="GeneID:108029766"
                     /translation="
MASATSSSARHLFDESKKRLCARVGVNVNNLGSVARQVVRGSKSNEIMHQTLKNFTQVDVVSEYSHQNLQKMTLILQHVGYQYDVMQDSVNHLDYLKEQVTAMER"
     misc_feature    94..402
                     /gene="LOC108029766"
                     /note="BLOC-1-related complex sub-unit 7; Region: BORCS7;
                     pfam16088"
                     /db_xref="CDD:465012"
ORIGIN      
gccattaaatattttatctcagctgtttctccctgactttgtttacaattagcgagtttattaacatttaaacagcgttaaaccataaataaaatggcctctgcgaccagttcaagtgctcgacatttattcgacgagtccaagaagagattgtgtgcccgcgtgggtgtaaacgtgaataatttgggatctgtggcccgacaggttgtcaggggctccaagagcaacgagatcatgcatcaaaccctgaagaacttcacccaagtggacgtggtctcggaatacagccaccagaatctgcagaagatgacgctgatcctgcagcacgtgggctaccagtacgatgtgatgcaggatagtgtcaaccacttggattacctcaaggagcaggtgacggccatggaaagatga
//

by @meso_cacase at DBCLS
This page is licensed under a Creative Commons Attribution 4.0 International License (CC BY 4.0).

If you use GGRNA in your work, please cite:
Naito Y, Bono H. (2012)
GGRNA: an ultrafast, transcript-oriented search engine for genes and transcripts.
Nucleic Acids Res., 40, W592-W596. [Full Text]