GGRNA ver.2 Home | Help | Advanced search    Previous release (v1)

2024-04-19 19:16:46, GGRNA.v2 : RefSeq release 222 (Jan, 2024)

LOCUS       XM_015572856            2604 bp    mRNA    linear   MAM 09-FEB-2016
DEFINITION  PREDICTED: Myotis davidii argonaute 4, RISC catalytic component
            (AGO4), transcript variant X2, mRNA.
ACCESSION   XM_015572856
VERSION     XM_015572856.1
DBLINK      BioProject: PRJNA232515
KEYWORDS    RefSeq.
SOURCE      Myotis davidii
  ORGANISM  Myotis davidii
            Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
            Mammalia; Eutheria; Laurasiatheria; Chiroptera; Microchiroptera;
            Vespertilionidae; Myotis.
COMMENT     MODEL REFSEQ:  This record is predicted by automated computational
            analysis. This record is derived from a genomic sequence
            (NW_006300377.1) annotated using gene prediction method: Gnomon.
            Also see:
                Documentation of NCBI's Annotation Process
            
            ##Genome-Annotation-Data-START##
            Annotation Provider         :: NCBI
            Annotation Status           :: Full annotation
            Annotation Version          :: Myotis davidii Annotation Release
                                           101
            Annotation Pipeline         :: NCBI eukaryotic genome annotation
                                           pipeline
            Annotation Software Version :: 6.5
            Annotation Method           :: Best-placed RefSeq; Gnomon
            Features Annotated          :: Gene; mRNA; CDS; ncRNA
            ##Genome-Annotation-Data-END##
FEATURES             Location/Qualifiers
     source          1..2604
                     /organism="Myotis davidii"
                     /mol_type="mRNA"
                     /db_xref="taxon:225400"
                     /chromosome="Unknown"
                     /sex="male"
                     /tissue_type="spleen, kidney and small intestine"
                     /country="China: Taiyi Cave, Xianning, Wuhan, Hubei
                     Province"
                     /collection_date="21-Aug-2011"
     gene            1..2604
                     /gene="AGO4"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Gnomon. Supporting evidence
                     includes similarity to: 1 Protein, and 100% coverage of
                     the annotated genomic feature by RNAseq alignments,
                     including 2 samples with support for all annotated
                     introns"
                     /db_xref="GeneID:102751587"
     CDS             99..2174
                     /gene="AGO4"
                     /codon_start=1
                     /product="protein argonaute-4 isoform X2"
                     /protein_id="XP_015428342.1"
                     /db_xref="GeneID:102751587"
                     /translation="
MVRHFKMQIFGDRQPGYDGKRNMYTAHPLPIGRDRVDMEVTLPGEGKDQTFKVSVQWVSVVSLQMLLEALAGHLNEVPDDSVQALDVITRHLPSMRYTPVGRSFFSPPEGYYHPLGGGREVWFGFHQSVRPAMWNMMLNIDVSATAFYRAQPIIEFMCEVLDIQNINEQTKPLTDSQRVKFTKEIRGLKVEVTHCGQMKRKYRVCNVTRRPASHQTFPLQLENGQAMECTVAQYFKQKYSLQLKYPHLPCLQVGQEQKHTYLPLEVCNIVAGQRCIKKLTDNQTSTMIKATARSAPDRQEEISRLVKSNSMVGGPDPYLKEFGIVVHNEMTELTGRVLPAPMLQYGGRNKTVATPNQGVWDMRGKQFYAGIEIKVWAVACFAPQKQCREDLLKSFTDQLRKISKDAGMPIQGQPCFCKYAQGADSVEPMFKHLKMTYVGLQLIVVILPGKTPVYAEVKRVGDTLLGMATQCVQVKNVVKTSPQTLSNLCLKINAKLGGINNVLVPHQRPSVFQQPVIFLGADVTHPPAGDGKKPSIAAVVGSMDGHPSRYCATVRVQTSRQEVSQELLYSQEVIQDLTNMVRELLIQFYKSTRFKPTRIIYYRGGVSEGQMKQVAWPELIAIRKACISLEEDYRPGITYIVVQKRHHTRLFCADKAERMYLYALVYDPQLKITTGRMEPNKLPSNLCLDGK"
     misc_feature    108..362
                     /gene="AGO4"
                     /note="N-terminal domain of argonaute; Region: ArgoN;
                     pfam16486"
                     /db_xref="CDD:435368"
     misc_feature    393..545
                     /gene="AGO4"
                     /note="Argonaute linker 1 domain; Region: ArgoL1;
                     pfam08699"
                     /db_xref="CDD:430160"
     misc_feature    546..908
                     /gene="AGO4"
                     /note="PAZ domain, argonaute_like subfamily. Argonaute is
                     part of the RNA-induced silencing complex (RISC), and is
                     an endonuclease that plays a key role in the RNA
                     interference pathway. The PAZ domain has been named after
                     the proteins Piwi,Argonaut, and Zwille; Region:
                     PAZ_argonaute_like; cd02846"
                     /db_xref="CDD:239212"
     misc_feature    order(702..704,747..749,789..791,801..803,855..857,
                     876..878,882..884)
                     /gene="AGO4"
                     /note="nucleic acid-binding interface [nucleotide
                     binding]; other site"
                     /db_xref="CDD:239212"
     misc_feature    1047..>2072
                     /gene="AGO4"
                     /note="PIWI domain, Argonaute-like subfamily. Argonaute is
                     the central component of the RNA-induced silencing complex
                     (RISC) and related complexes. The PIWI domain is the
                     C-terminal portion of Argonaute and consists of two
                     subdomains, one of which provides the...; Region:
                     Piwi_ago-like; cd04657"
                     /db_xref="CDD:240015"
     misc_feature    order(1458..1460,1470..1472,1506..1517,1524..1526,
                     1548..1550,1557..1559,1569..1571,1581..1583)
                     /gene="AGO4"
                     /note="5' RNA guide strand anchoring site [active]"
                     /db_xref="CDD:240015"
ORIGIN      
ttcaggttcagattcctaaaatagatgtgtatcactatgatgtggatattaaaccagaaaaacggcctcgtagagtcaacagggaggtagtagatacaatggtgcggcacttcaagatgcaaatatttggtgatcggcagcctggctatgatggcaaaagaaacatgtacacagcacatccactgccaattggacgggatagggttgatatggaagtgacccttccaggtgagggtaaagaccaaacctttaaagtgtctgttcagtgggtgtccgttgtgagccttcagatgcttttagaagctttagctgggcacttaaatgaagtcccagatgactcagtacaagcacttgatgttattacaagacacctcccctccatgaggtacactccagtgggccgttcctttttctcacccccggaaggttactaccaccctctgggagggggcagggaggtttggtttggctttcatcagtctgtgagacctgccatgtggaatatgatgctcaatattgatgtatctgcaaccgctttctaccgggctcagcctatcattgagttcatgtgtgaggtattggacattcagaatatcaacgaacagaccaaacctctaacggactcccagcgtgtcaagtttaccaaagaaatcagaggtcttaaagttgaggtgactcactgtggacagatgaagcgaaaatatcgagtttgtaatgtaaccagacggccagccagtcatcaaacttttcctttacagctagaaaatggtcaagccatggaatgtactgtagctcaatattttaagcaaaagtatagtctgcagctgaaatatccccatcttccctgtctccaagtgggacaagaacaaaagcatacatacttgccacttgaggtctgtaatatagtggcaggacagcgatgtataaagaaacttacagacaatcagacttccacgatgatcaaagccacagcaagatctgctcctgacagacaggaagaaatcagtagactggtgaagagtaacagcatggtgggtggacctgatccataccttaaagaatttggtattgttgtccacaatgaaatgacagagctcacaggcagggtacttccagcaccaatgctccagtatggaggccggaataaaacagtagccacacccaaccagggtgtctgggacatgcgaggaaagcagttttatgctggcattgaaattaaagtttgggcagttgcttgttttgcgcctcagaaacaatgtagggaagatttactaaagagtttcactgaccagctccgtaaaatctctaaggatgcgggaatgcccatccagggccagccatgtttctgcaagtatgcacaaggtgcagacagcgtggagcctatgtttaaacacctgaaaatgacatatgtgggcctacagctaatagtggtgatcttgcctgggaagacaccagtatatgcggaggtgaaacgtgttggagataccctcctgggcatggccacgcagtgtgtccaggtaaaaaatgtagtgaagacctcaccccagaccctttccaacctttgcctgaagataaatgcaaagcttggaggaattaacaacgtgcttgtacctcatcaaaggccatcagtgttccagcagcctgtcatcttcctgggagcagatgtcacccacccccctgcaggggacgggaagaagccttccattgctgctgtcgtaggcagtatggatggccaccccagccggtactgtgccactgttcgggtgcagacctcccgccaggaggtctcccaggagctcctctatagtcaggaggtgatccaggacctcactaacatggttcgagagctgctgatccagttctacaagtccacacgcttcaaacctacacggatcatctattaccgtggaggggtatccgagggacaaatgaaacaggtagcttggccagaactaatagcaattcgaaaggcatgtattagcttggaagaagattaccggccaggaataacctacattgtggtacagaaaagacatcacacacgactcttctgtgcggataaagcagaaaggatgtacttgtatgcattggtgtatgaccctcagctgaagataaccacagggagaatggagccaaataaactcccatcaaatttgtgcctagatggcaaataaaattcctcacatggaaccctgctgtacagcagaagagaatgaaaattgtccaaatagcaagatttcatttctttccttgtaaatgcatttctgaagttctccctctgcttttctagaagtttaatcctagagttttggccattgaagaactttggaatttttaaagtgtaagatattgttattggattttgtagctgattagattgaggcccaacaatatgctttgttcaaggtatggagttgcaacgctaggcctagatctgaaactctggcttcctgatcccatttcagtggactcttcctgataaggcatctgccagtgtcttcttttattgatcccctaaaagtgttagttttattgaaccagttcaaagatttcttcatcttgccagagccattttggctcagtggatagaacatcggcctgtgg
//

by @meso_cacase at DBCLS
This page is licensed under a Creative Commons Attribution 4.0 International License (CC BY 4.0).

If you use GGRNA in your work, please cite:
Naito Y, Bono H. (2012)
GGRNA: an ultrafast, transcript-oriented search engine for genes and transcripts.
Nucleic Acids Res., 40, W592-W596. [Full Text]