2024-04-19 19:16:46, GGRNA.v2 : RefSeq release 222 (Jan, 2024)
LOCUS XM_015572856 2604 bp mRNA linear MAM 09-FEB-2016 DEFINITION PREDICTED: Myotis davidii argonaute 4, RISC catalytic component (AGO4), transcript variant X2, mRNA. ACCESSION XM_015572856 VERSION XM_015572856.1 DBLINK BioProject: PRJNA232515 KEYWORDS RefSeq. SOURCE Myotis davidii ORGANISM Myotis davidii Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia; Eutheria; Laurasiatheria; Chiroptera; Microchiroptera; Vespertilionidae; Myotis. COMMENT MODEL REFSEQ: This record is predicted by automated computational analysis. This record is derived from a genomic sequence (NW_006300377.1) annotated using gene prediction method: Gnomon. Also see: Documentation of NCBI's Annotation Process ##Genome-Annotation-Data-START## Annotation Provider :: NCBI Annotation Status :: Full annotation Annotation Version :: Myotis davidii Annotation Release 101 Annotation Pipeline :: NCBI eukaryotic genome annotation pipeline Annotation Software Version :: 6.5 Annotation Method :: Best-placed RefSeq; Gnomon Features Annotated :: Gene; mRNA; CDS; ncRNA ##Genome-Annotation-Data-END## FEATURES Location/Qualifiers source 1..2604 /organism="Myotis davidii" /mol_type="mRNA" /db_xref="taxon:225400" /chromosome="Unknown" /sex="male" /tissue_type="spleen, kidney and small intestine" /country="China: Taiyi Cave, Xianning, Wuhan, Hubei Province" /collection_date="21-Aug-2011" gene 1..2604 /gene="AGO4" /note="Derived by automated computational analysis using gene prediction method: Gnomon. Supporting evidence includes similarity to: 1 Protein, and 100% coverage of the annotated genomic feature by RNAseq alignments, including 2 samples with support for all annotated introns" /db_xref="GeneID:102751587" CDS 99..2174 /gene="AGO4" /codon_start=1 /product="protein argonaute-4 isoform X2" /protein_id="XP_015428342.1" /db_xref="GeneID:102751587" /translation="
MVRHFKMQIFGDRQPGYDGKRNMYTAHPLPIGRDRVDMEVTLPGEGKDQTFKVSVQWVSVVSLQMLLEALAGHLNEVPDDSVQALDVITRHLPSMRYTPVGRSFFSPPEGYYHPLGGGREVWFGFHQSVRPAMWNMMLNIDVSATAFYRAQPIIEFMCEVLDIQNINEQTKPLTDSQRVKFTKEIRGLKVEVTHCGQMKRKYRVCNVTRRPASHQTFPLQLENGQAMECTVAQYFKQKYSLQLKYPHLPCLQVGQEQKHTYLPLEVCNIVAGQRCIKKLTDNQTSTMIKATARSAPDRQEEISRLVKSNSMVGGPDPYLKEFGIVVHNEMTELTGRVLPAPMLQYGGRNKTVATPNQGVWDMRGKQFYAGIEIKVWAVACFAPQKQCREDLLKSFTDQLRKISKDAGMPIQGQPCFCKYAQGADSVEPMFKHLKMTYVGLQLIVVILPGKTPVYAEVKRVGDTLLGMATQCVQVKNVVKTSPQTLSNLCLKINAKLGGINNVLVPHQRPSVFQQPVIFLGADVTHPPAGDGKKPSIAAVVGSMDGHPSRYCATVRVQTSRQEVSQELLYSQEVIQDLTNMVRELLIQFYKSTRFKPTRIIYYRGGVSEGQMKQVAWPELIAIRKACISLEEDYRPGITYIVVQKRHHTRLFCADKAERMYLYALVYDPQLKITTGRMEPNKLPSNLCLDGK"
misc_feature 108..362 /gene="AGO4" /note="N-terminal domain of argonaute; Region: ArgoN; pfam16486" /db_xref="CDD:435368" misc_feature 393..545 /gene="AGO4" /note="Argonaute linker 1 domain; Region: ArgoL1; pfam08699" /db_xref="CDD:430160" misc_feature 546..908 /gene="AGO4" /note="PAZ domain, argonaute_like subfamily. Argonaute is part of the RNA-induced silencing complex (RISC), and is an endonuclease that plays a key role in the RNA interference pathway. The PAZ domain has been named after the proteins Piwi,Argonaut, and Zwille; Region: PAZ_argonaute_like; cd02846" /db_xref="CDD:239212" misc_feature order(702..704,747..749,789..791,801..803,855..857, 876..878,882..884) /gene="AGO4" /note="nucleic acid-binding interface [nucleotide binding]; other site" /db_xref="CDD:239212" misc_feature 1047..>2072 /gene="AGO4" /note="PIWI domain, Argonaute-like subfamily. Argonaute is the central component of the RNA-induced silencing complex (RISC) and related complexes. The PIWI domain is the C-terminal portion of Argonaute and consists of two subdomains, one of which provides the...; Region: Piwi_ago-like; cd04657" /db_xref="CDD:240015" misc_feature order(1458..1460,1470..1472,1506..1517,1524..1526, 1548..1550,1557..1559,1569..1571,1581..1583) /gene="AGO4" /note="5' RNA guide strand anchoring site [active]" /db_xref="CDD:240015" ORIGIN
ttcaggttcagattcctaaaatagatgtgtatcactatgatgtggatattaaaccagaaaaacggcctcgtagagtcaacagggaggtagtagatacaatggtgcggcacttcaagatgcaaatatttggtgatcggcagcctggctatgatggcaaaagaaacatgtacacagcacatccactgccaattggacgggatagggttgatatggaagtgacccttccaggtgagggtaaagaccaaacctttaaagtgtctgttcagtgggtgtccgttgtgagccttcagatgcttttagaagctttagctgggcacttaaatgaagtcccagatgactcagtacaagcacttgatgttattacaagacacctcccctccatgaggtacactccagtgggccgttcctttttctcacccccggaaggttactaccaccctctgggagggggcagggaggtttggtttggctttcatcagtctgtgagacctgccatgtggaatatgatgctcaatattgatgtatctgcaaccgctttctaccgggctcagcctatcattgagttcatgtgtgaggtattggacattcagaatatcaacgaacagaccaaacctctaacggactcccagcgtgtcaagtttaccaaagaaatcagaggtcttaaagttgaggtgactcactgtggacagatgaagcgaaaatatcgagtttgtaatgtaaccagacggccagccagtcatcaaacttttcctttacagctagaaaatggtcaagccatggaatgtactgtagctcaatattttaagcaaaagtatagtctgcagctgaaatatccccatcttccctgtctccaagtgggacaagaacaaaagcatacatacttgccacttgaggtctgtaatatagtggcaggacagcgatgtataaagaaacttacagacaatcagacttccacgatgatcaaagccacagcaagatctgctcctgacagacaggaagaaatcagtagactggtgaagagtaacagcatggtgggtggacctgatccataccttaaagaatttggtattgttgtccacaatgaaatgacagagctcacaggcagggtacttccagcaccaatgctccagtatggaggccggaataaaacagtagccacacccaaccagggtgtctgggacatgcgaggaaagcagttttatgctggcattgaaattaaagtttgggcagttgcttgttttgcgcctcagaaacaatgtagggaagatttactaaagagtttcactgaccagctccgtaaaatctctaaggatgcgggaatgcccatccagggccagccatgtttctgcaagtatgcacaaggtgcagacagcgtggagcctatgtttaaacacctgaaaatgacatatgtgggcctacagctaatagtggtgatcttgcctgggaagacaccagtatatgcggaggtgaaacgtgttggagataccctcctgggcatggccacgcagtgtgtccaggtaaaaaatgtagtgaagacctcaccccagaccctttccaacctttgcctgaagataaatgcaaagcttggaggaattaacaacgtgcttgtacctcatcaaaggccatcagtgttccagcagcctgtcatcttcctgggagcagatgtcacccacccccctgcaggggacgggaagaagccttccattgctgctgtcgtaggcagtatggatggccaccccagccggtactgtgccactgttcgggtgcagacctcccgccaggaggtctcccaggagctcctctatagtcaggaggtgatccaggacctcactaacatggttcgagagctgctgatccagttctacaagtccacacgcttcaaacctacacggatcatctattaccgtggaggggtatccgagggacaaatgaaacaggtagcttggccagaactaatagcaattcgaaaggcatgtattagcttggaagaagattaccggccaggaataacctacattgtggtacagaaaagacatcacacacgactcttctgtgcggataaagcagaaaggatgtacttgtatgcattggtgtatgaccctcagctgaagataaccacagggagaatggagccaaataaactcccatcaaatttgtgcctagatggcaaataaaattcctcacatggaaccctgctgtacagcagaagagaatgaaaattgtccaaatagcaagatttcatttctttccttgtaaatgcatttctgaagttctccctctgcttttctagaagtttaatcctagagttttggccattgaagaactttggaatttttaaagtgtaagatattgttattggattttgtagctgattagattgaggcccaacaatatgctttgttcaaggtatggagttgcaacgctaggcctagatctgaaactctggcttcctgatcccatttcagtggactcttcctgataaggcatctgccagtgtcttcttttattgatcccctaaaagtgttagttttattgaaccagttcaaagatttcttcatcttgccagagccattttggctcagtggatagaacatcggcctgtgg
//
by
@meso_cacase at
DBCLS
This page is licensed under a
Creative Commons Attribution 4.0 International License (CC BY 4.0).
If you use GGRNA in your work, please cite:
Naito Y, Bono H. (2012)
GGRNA: an ultrafast, transcript-oriented search engine for genes and transcripts.
Nucleic Acids Res., 40, W592-W596.
[Full Text]