ver.2
Home
|
Help
|
Advanced search
Previous release (v1)
2026-10-30 01:58:45, GGRNA.v2 : RefSeq release 233 (Jan, 2026)
LOCUS XM_014820060 5674 bp mRNA linear INV 01-DEC-2015
DEFINITION PREDICTED: Priapulus caudatus copper-transporting ATPase 1-like
(LOC106815582), mRNA.
ACCESSION XM_014820060
VERSION XM_014820060.1
DBLINK BioProject: PRJNA303167
KEYWORDS RefSeq; corrected model.
SOURCE Priapulus caudatus
ORGANISM Priapulus caudatus
Eukaryota; Metazoa; Ecdysozoa; Scalidophora; Priapulida;
Priapulimorpha; Priapulimorphida; Priapulidae; Priapulus.
COMMENT MODEL REFSEQ: This record is predicted by automated computational
analysis. This record is derived from a genomic sequence
(NW_014577090.1) annotated using gene prediction method: Gnomon.
Also see:
Documentation of NCBI's Annotation Process
##Genome-Annotation-Data-START##
Annotation Provider :: NCBI
Annotation Status :: Full annotation
Annotation Version :: Priapulus caudatus Annotation
Release 100
Annotation Pipeline :: NCBI eukaryotic genome annotation
pipeline
Annotation Software Version :: 6.5
Annotation Method :: Best-placed RefSeq; Gnomon
Features Annotated :: Gene; mRNA; CDS; ncRNA
##Genome-Annotation-Data-END##
##RefSeq-Attributes-START##
frameshifts :: corrected 2 indels
internal stop codons :: corrected 2 genomic stop codons
##RefSeq-Attributes-END##
PRIMARY REFSEQ_SPAN PRIMARY_IDENTIFIER PRIMARY_SPAN COMP
1-247 AXZU02003241.1 2097-2343 c
248-436 AXZU02003240.1 16228-16416 c
437-652 AXZU02003240.1 9021-9236 c
653-778 AXZU02003240.1 7226-7351 c
779-1382 AXZU02003240.1 5484-6087 c
1383-1529 AXZU02003240.1 4726-4872 c
1530-1600 AXZU02003240.1 4386-4456 c
1601-1721 AXZU02003240.1 3092-3212 c
1722-1885 AXZU02003240.1 2496-2659 c
1886-2047 AXZU02003240.1 1872-2033 c
2048-2130 AXZU02003240.1 1448-1530 c
2131-2287 AXZU02003239.1 18415-18571 c
2288-2518 AXZU02003239.1 17961-18191 c
2519-2659 AXZU02003239.1 17310-17450 c
2660-2776 AXZU02003239.1 16951-17067 c
2777-3037 AXZU02003239.1 16368-16628 c
3038-3229 AXZU02003239.1 15921-16112 c
3230-3236 AXZU02003239.1 13843-13849 c
3237-3280 AXZU02003239.1 10670-10713 c
3281-3391 AXZU02003239.1 10558-10668 c
3392-3420 AXZU02003239.1 10528-10556 c
3421-3542 AXZU02003239.1 10011-10132 c
3543-3773 AXZU02003239.1 7859-8089 c
3774-3916 AXZU02003239.1 7124-7266 c
3917-4120 AXZU02003239.1 6661-6864 c
4121-4238 AXZU02003239.1 6329-6446 c
4239-4341 AXZU02003239.1 5801-5903 c
4342-5674 AXZU02003239.1 4125-5457 c
FEATURES Location/Qualifiers
source 1..5674
/organism="Priapulus caudatus"
/mol_type="mRNA"
/isolation_source="mud"
/db_xref="taxon:37621"
/chromosome="Unknown"
/sex="male"
/geo_loc_name="Sweden: Gulmarsfjord"
/lat_lon="58.270 N 11.453 E"
gene 1..5674
/gene="LOC106815582"
/note="The sequence of the model RefSeq transcript was
modified relative to its source genomic sequence to
represent the inferred CDS: deleted 2 bases in 2 codons;
Derived by automated computational analysis using gene
prediction method: Gnomon. Supporting evidence includes
similarity to: 12 Proteins, and 92% coverage of the
annotated genomic feature by RNAseq alignments"
/db_xref="GeneID:106815582"
CDS 287..4645
/gene="LOC106815582"
/note="The sequence of the model RefSeq protein was
modified relative to its source genomic sequence to
represent the inferred CDS: deleted 2 bases in 2 codons;
substituted 2 bases at 2 genomic stop codons"
/codon_start=1
/transl_except=(pos:3314..3316,aa:OTHER)
/transl_except=(pos:3554..3556,aa:OTHER)
/product="LOW QUALITY PROTEIN: copper-transporting ATPase
1-like"
/protein_id="XP_014675546.1"
/db_xref="GeneID:106815582"
/translation="
MENISKHKEFANHSTNGNVAVISVKGMTCQSCVNTIEENIGKLDGIYEIKVSLGNKEAVVRFDESMTSAMEITDGIENMGFEAELECHLVRRVIAVEGMTCQSCVQTIQHKVVALQGVHSVQVSLETKIATVTYDAKITTTDAVMTAIDETGFIASLIQSKLEQSHVQVRVEGMTCQSCVNSIQDVIGKMPGVTSIVVSLSKKLAFVDHIPSVVSADDLCSAINDMGFDADLASAPPTDTTAVATVETTGDATCFVMIEGMTCQSCVKNIEGHISSVSGVRNISVSLKHKCATVMYDSGAISAAKVTDMIDDMGFIATLSDAPIVAPPGVKTQDVSHLNVPTGDVETYMLEVTGMTCKSCVRKIEERVREEEGVISVAVSLQEEQAIVKLNPHVTSIGNVRMTINQMGFMASLPGSLQIARSVSFQKLPLVDRKEVKQQNGGTVEVSLEDIEKCHLQVTGMTCASCVASIEKNLKKMEGIHDVLVALMASKAEVKYDPSYVLPQQIANHVIDLGFGCEVLEEGSPGEETIELLIRGMTCASCIHTIESRVAKVNGVNSAAVSLATSIGVFKFNPEVTGPRNVINAIEDSGYSAELVEKSKKSNIASLEHKRAIAQWRTSFFINLCFGLPTFIVMFYYMFSPYKEHIEVFAGLSLENLLLFCFCTPVQFIGGRHFYVQAMKALKHRSTNMDVLIMMATSIAYIYSIIVVAIAIVQGSKSPMTFFDAPPMLLVFISLGRWLEYIAKGKTSEAITKLMSLQATEAVLVEQDADGNVMSEKRINVELVQRGDILKVMPGEKVPVDARVIEGSSMADESLVTGEAMPVLKKPGSQVIGGSINQNGTLLIRATHVGTDTALAQIVRLVEEAQTSKAPIQALADKIAGFFVPMVIIASSLTCIVWIIIGHRNIAAIDPDFIPPEEGGSFSKTSITVEFAFRMAITVLAIACPCALGLATPTAVMVGTGVGAQQGILIKGGEPLETAHKLQCGAIVFDKTGTITHAVPHVTRVGFCSXRSECAASTRCCGGARTAEASSEHPIASAIRQIVKEWLRTDRMGKCTDFQAVPGCGLSASVSNVREPMLGRHRQGTNNRVXNQKVLKSQSVCNSHHCFPVVLVEGTPASKEYKVLIGNREWMNRNGLVVGEEVEARMSEHEILGQTAVLVAIDGVLVSMVAVADTVKAEAHLAVYTLKKSGLHVILLTGDNRKTAKAIAMQVGITKVFAEVLPSHKVAKIKQLQAKGMKVAMVGDGVNDSPALAQADVGIAIASGTDVAVEAADMVLIRNDLLDTVAAIDLSHKTVWRIRLNFLFASIYNIFGIPIAAGVLKPIGFSLQPWMAAAAMAASSVSVLCSSLLLKMYRKPVRMTLETDDYLNHLRMEALMLVANGDNISVHRGIDDDLPDDRGQRSSLKSSISEKLSQIGSKVYRLSQGGVQQRGLNQGLLSSGSSDGDDPYISRL"
misc_feature 347..538
/gene="LOC106815582"
/note="Heavy-metal-associated domain (HMA) is a conserved
domain of approximately 30 amino acid residues found in a
number of proteins that transport or detoxify heavy
metals, for example, the CPx-type heavy metal ATPases and
copper chaperones. HMA domain...; Region: HMA; cd00371"
/db_xref="CDD:238219"
misc_feature order(365..373,380..382)
/gene="LOC106815582"
/note="metal-binding site [ion binding]"
/db_xref="CDD:238219"
misc_feature 563..763
/gene="LOC106815582"
/note="Copper chaperone CopZ [Inorganic ion transport and
metabolism]; Region: CopZ; COG2608"
/db_xref="CDD:442020"
misc_feature 788..976
/gene="LOC106815582"
/note="Heavy-metal-associated domain (HMA) is a conserved
domain of approximately 30 amino acid residues found in a
number of proteins that transport or detoxify heavy
metals, for example, the CPx-type heavy metal ATPases and
copper chaperones. HMA domain...; Region: HMA; cd00371"
/db_xref="CDD:238219"
misc_feature order(806..814,821..823)
/gene="LOC106815582"
/note="metal-binding site [ion binding]"
/db_xref="CDD:238219"
misc_feature 1052..1240
/gene="LOC106815582"
/note="Heavy-metal-associated domain (HMA) is a conserved
domain of approximately 30 amino acid residues found in a
number of proteins that transport or detoxify heavy
metals, for example, the CPx-type heavy metal ATPases and
copper chaperones. HMA domain...; Region: HMA; cd00371"
/db_xref="CDD:238219"
misc_feature order(1067..1075,1082..1084)
/gene="LOC106815582"
/note="metal-binding site [ion binding]"
/db_xref="CDD:238219"
misc_feature 1331..1522
/gene="LOC106815582"
/note="Heavy-metal-associated domain (HMA) is a conserved
domain of approximately 30 amino acid residues found in a
number of proteins that transport or detoxify heavy
metals, for example, the CPx-type heavy metal ATPases and
copper chaperones. HMA domain...; Region: HMA; cd00371"
/db_xref="CDD:238219"
misc_feature order(1349..1357,1364..1366)
/gene="LOC106815582"
/note="metal-binding site [ion binding]"
/db_xref="CDD:238219"
misc_feature 1652..1840
/gene="LOC106815582"
/note="Heavy-metal-associated domain (HMA) is a conserved
domain of approximately 30 amino acid residues found in a
number of proteins that transport or detoxify heavy
metals, for example, the CPx-type heavy metal ATPases and
copper chaperones. HMA domain...; Region: HMA; cd00371"
/db_xref="CDD:238219"
misc_feature order(1667..1675,1682..1684)
/gene="LOC106815582"
/note="metal-binding site [ion binding]"
/db_xref="CDD:238219"
misc_feature 1868..2077
/gene="LOC106815582"
/note="Copper chaperone CopZ [Inorganic ion transport and
metabolism]; Region: CopZ; COG2608"
/db_xref="CDD:442020"
misc_feature 2144..4276
/gene="LOC106815582"
/note="P-type heavy metal-transporting ATPase, similar to
human copper-transporting ATPases, ATP7A and ATP7B;
Region: P-type_ATPase_Cu-like; cd02094"
/db_xref="CDD:319783"
misc_feature order(3116..3118,3122..3124,4208..4210)
/gene="LOC106815582"
/note="putative Cu binding site [ion binding]; other site"
/db_xref="CDD:319783"
misc_feature order(3254..3262,3467..3469,3659..3667,3755..3757,
3875..3883,3941..3943,3950..3952,3959..3961,4016..4018,
4025..4027)
/gene="LOC106815582"
/note="putative ATP binding site [chemical binding]; other
site"
/db_xref="CDD:319783"
ORIGIN
ggcactgttgttgatttctttggatctttgctgcaggttcctgtgtttgtgttacattattgtatctagttgtctgctagtactgtagtagtaaacttactgcaagtttttaaacttgtgagttgtgtacagctgaagcaatctgatctacgcaatgataaaaccataaatgataaaacttaaaaggtaaaacagctgtagacctacaacaagtgagtgtaaagagtactgcagtacaggtaccgagaaaccaagaggcagtgttattacttaatcatcagaaaccatggaaaatataagcaagcacaaggaattcgctaatcattcaactaatggcaatgtagcagtcatctctgtaaagggcatgacgtgtcagtcatgtgtcaacaccatcgaggaaaacattggaaaactcgatggcatatatgagatcaaggtgtcgcttggcaacaaggaggcagtggttagatttgatgagagcatgacatcggccatggaaatcactgatggcatagagaacatgggctttgaggcagaactagagtgccacctggtgagaagagtcatcgctgtcgagggcatgacatgtcagtcatgcgttcagacgatccaacacaaggtcgtagctctgcagggtgtgcattctgtgcaggtatccttggagaccaagatcgcaacagtaacatacgatgcgaagataacaactacggatgctgtcatgacagcgattgatgagacaggcttcattgcctctctcatacagtccaagctagagcagtcacatgtgcaagtccgagtggagggaatgacctgccagtcgtgtgtcaacagcatacaggatgtcattggcaagatgccaggtgtcaccagcattgtcgtgtctctcagcaagaagctggcatttgttgatcacattccatcggtcgtctcagcagacgacttatgcagcgcgatcaatgacatgggcttcgatgccgatcttgcatcagcgccacctactgacacaacagctgtagctacagtcgagaccaccggtgatgccacttgttttgtgatgatagagggcatgacctgtcagtcgtgcgtgaagaacattgaaggtcacatttcgtccgtgagtggagtgagaaatatctccgtctccctgaagcataagtgtgccaccgtgatgtacgacagtggcgccatctctgcagccaaagtcaccgacatgatcgacgacatgggtttcatagcaacgctgtcggacgccccgatcgtagcaccacctggtgtgaagacgcaggacgtgtcccatctgaacgtgccaacaggagatgtggaaacttatatgttggaggtaacaggcatgacgtgcaagtcctgtgtcaggaaaatagaagagcgtgtgagggaggaggagggcgtgatctcggtggcagtgtcgctacaggaggaacaagccattgttaagctgaatccgcatgtgacaagcattggcaatgtacgcatgaccatcaaccagatggggttcatggcttctctaccgggcagtcttcaaattgctcgcagcgtctcattccaaaagcttcccttagttgaccgcaaagaagtgaagcagcagaatggtggaacggtggaggtgtcattggaggatattgagaagtgccatctacaggtaacaggcatgacctgcgcctcctgtgtagcatccattgagaagaatctaaagaagatggagggtatacatgatgtacttgtggcattgatggcatccaaggcagaggtgaagtacgatccatcctacgttctcccccagcagatagctaaccatgtcatcgacctaggcttcggctgtgaggtgctggaagagggaagccctggtgaggaaacgatagagctgctgatcagagggatgacctgtgcatcgtgcatacacaccatagagtcacgtgttgctaaggtgaacggtgtcaactctgctgccgtctccctggcaacgtccatcggtgttttcaaattcaatccagaggttacgggaccacgcaatgttatcaacgcaatagaggattctggatattctgctgaactagtggagaaaagtaaaaagtcgaatattgcctcgctggaacacaagcgagccattgcacagtggagaacttcattctttattaacctttgcttcggactacccaccttcatcgttatgttctactacatgttctcaccatataaggaacacatcgaagtgttcgcaggcctctcactggaaaacctactgctgttctgcttctgcacacctgtgcagttcatcggcggaagacacttctacgttcaagcgatgaaggcactcaagcaccgcagcacgaacatggacgtgctgataatgatggcgaccagtattgcctacatctactcgatcatcgtcgtcgccatcgcgatagtgcaaggctccaaaagtccgatgacgttcttcgatgcaccgccaatgttactcgtcttcatctcgctcggacgctggctggagtacatcgccaagggtaagacatctgaagcaatcactaagctgatgtcgctgcaggcaacagaggccgttctggttgagcaagatgcagatggaaacgtcatgtcagagaaacgcataaacgttgagcttgtgcagcgtggagacattctcaaggtgatgccgggagagaaggtgccggtggatgctcgtgtgatcgaaggttcctcgatggctgatgaatcgctcgtgacaggagaagccatgcccgtgctgaagaaacctggatctcaggtcatcggtggatcgatcaatcaaaatggtacactgttgattcgcgcaacgcacgttggcacggacaccgcgctcgctcagatagtccgcctggtggaggaagcgcaaacctcgaaggcgccgatccaagctcttgctgacaagattgctggcttctttgttcccatggtgatcattgcgtcgagtctcacgtgcattgtgtggataatcataggacatcgcaacatcgccgccatcgatcctgacttcatacctcctgaggaaggaggcagcttcagtaagacttccattacggtagagtttgccttccgcatggccattacggtgctggcgatcgcgtgcccctgtgccctcggtcttgccacgcccactgcagtcatggtcggcaccggagtgggagcacagcagggcatactcatcaagggaggtgaaccgcttgagactgctcacaagctacagtgtggtgcgattgtatttgacaagactggaacgatcactcatgcggtgcctcacgtcacgcgtgtcggcttctgttcgtagcggagtgagtgtgcagcgtccaccaggtgctgcggtggtgctaggacagctgaagccagctcggagcatcctatcgcatcagccatccgccaaatagtgaaagagtggctgaggacggacaggatgggtaaatgcacagacttccaggcagtgccaggctgtggcctgagtgcaagtgtcagcaacgtacgggaaccgatgctaggcagacacagacagggcacgaataatagggtttaaaaccagaaggtgttaaagtcccagtcagtgtgtaattctcaccattgttttcctgtagttcttgtagaggggacgccggcgtctaaggagtacaaggtgctgattggaaacagggagtggatgaatcgtaatggactggttgttggggaggaggtggaagcacgcatgagcgaacacgaaatactcggtcagaccgctgtgctggtggccatagatggggtgctggtgtccatggttgctgttgctgacactgtcaaggccgaggctcatctagctgtgtacacactgaagaagagcggtcttcacgtcatactgctgacaggggacaatcgcaagactgcgaaagctattgcaatgcaggtcggaatcacaaaggtgtttgcagaggtgctgccctcacacaaggttgctaagataaagcagctgcaggcaaaaggcatgaaggtcgcgatggtaggagacggagtgaatgactcgccagctcttgcgcaggcagacgtcggcattgctatagcaagcggcacggatgtagccgtggaagctgcagacatggtgctcatacggaatgatctactggataccgtggctgccatcgatctctcgcataaaactgtctggaggattcgtctcaacttcttatttgctagcatctataacatttttggcatccctattgcagcaggtgttctgaaaccgattggattctctctgcagccgtggatggctgctgctgctatggctgcctctagcgtgtccgtcctctgttcgtcactgctgctaaaaatgtatagaaagccagtacgcatgaccctcgagacggacgactacctcaatcatctgcgcatggaagctctgatgctggttgctaacggcgacaacatctccgttcatcgtggcatcgacgacgaccttcctgacgaccgcggtcaacgctcaagcctcaagagcagcatatcagagaaactgagtcagatcggcagcaaggtgtaccgtctgtcccaaggaggtgtgcagcagcgaggcttgaaccaggggctgctgagcagtggtagtagtgacggggatgacccctacatcagccgcttgtaaacagggcagtagggaagggcagaaccaacgtataacagctcaaaagtatagtcaggaagaagagagcccaggtatatagcaccctcatataaacatggagaatgggagttgccacctatatagcactgccatataaacagggaggagggagagcctatctatagcactcccatataaacagggaggagggggagcctatctatagcactcccatataaacaggggaaaggggaagcccacatataccagccccttccccagataaacaagggaaaggggaagcccgcctataccagccccttccccatataaacaaggggaaggggaagcccacctaaaccagccccttccccatataaacagtgaagaggggaattctactatagcacccatatatgagaagaaatgagaagataacaaacctgtaacactcacgcgtagacaggaaaaacgggaggcaacgttattaccatagaaatgtgtcgggctttaactgatattcagctacgttaggaagacacatggatacagggcatgtgtaaatagatgaagaggatgtatatccgggttatttttaatgcaagtatagaataggggggacaacgttggaaatcactgtttttaatgtgttttattcttatattatacatgatagagaattatatatttgcgagtttatgatgtgcagtctgtatgaaacgactgattatcctaaaatacatccagcaggtgaatattcggtgaaacatcgtgtattgtgaagctgcttaattttagttctgacagcagcctgttgggtgtgaattgtatgtttttttaaatacaattactattgggccaggactcaagtgattttacgctaggacatgaaattcttaaatcaggcacagtgtagcctaatatgtcaataatttttaattgtttttgtattgcaatattactaactataaaaaactatttatgccgaaattgcttattttaaaatcactgtattctgtatattttaaaataattggatattttaatcaa
//
by
@meso_cacase at
DBCLS
This page is licensed under a
Creative Commons Attribution 4.0 International License (CC BY 4.0).
If you use GGRNA in your work, please cite:
Naito Y, Bono H. (2012)
GGRNA: an ultrafast, transcript-oriented search engine for genes and transcripts.
Nucleic Acids Res., 40, W592-W596.
[Full Text]