GGRNA ver.2 Home | Help | Advanced search    Previous release (v1)

2025-12-08 04:08:13, GGRNA.v2 : RefSeq release 232 (Sep, 2025)

LOCUS       XM_014093812             645 bp    mRNA    linear   PLN 26-JUN-2024
DEFINITION  Trichoderma atroviride uncharacterized protein (TrAtP1_002718),
            partial mRNA.
ACCESSION   XM_014093812
VERSION     XM_014093812.2
DBLINK      BioProject: PRJNA1128265
            BioSample: SAMN17838941
KEYWORDS    RefSeq.
SOURCE      Trichoderma atroviride
  ORGANISM  Trichoderma atroviride
            Eukaryota; Fungi; Dikarya; Ascomycota; Pezizomycotina;
            Sordariomycetes; Hypocreomycetidae; Hypocreales; Hypocreaceae;
            Trichoderma.
REFERENCE   1  (bases 1 to 645)
  AUTHORS   Li,W.C., Lin,T.C., Chen,C.L., Liu,H.C., Lin,H.N., Chao,J.L.,
            Hsieh,C.H., Ni,H.F., Chen,R.S. and Wang,T.F.
  TITLE     Complete Genome Sequences and Genome-Wide Characterization of
            Trichoderma Biocontrol Agents Provide New Insights into their
            Evolution and Variation in Genome Organization, Sexual Development,
            and Fungal-Plant Interactions
  JOURNAL   Microbiol Spectr 9 (3), e0066321 (2021)
   PUBMED   34908505
REFERENCE   2  (bases 1 to 645)
  CONSRTM   NCBI Genome Project
  TITLE     Direct Submission
  JOURNAL   Submitted (26-JUN-2024) National Center for Biotechnology
            Information, NIH, Bethesda, MD 20894, USA
REFERENCE   3  (bases 1 to 645)
  AUTHORS   Li,W.-C., Lin,T.-C., Chen,C.-L., Liu,H.-C., Lin,H.-N., Hsieh,C.-H.,
            Ni,H.-F., Chen,R.-S. and Wang,T.-F.
  TITLE     Direct Submission
  JOURNAL   Submitted (21-JAN-2022) Institute of Molecular Biology, Academia
            Sinica, IMB, #128, Sec2, Academia Rd, Taipei 11529, Taiwan
  REMARK    Annotation added by submitter
REFERENCE   4  (bases 1 to 645)
  AUTHORS   Li,W.-C., Chen,C.-L., Lin,H.-N. and Wang,T.-F.
  TITLE     Direct Submission
  JOURNAL   Submitted (13-OCT-2021) Institute of Molecular Biology, Academia
            Sinica, IMB, #128, Sec2, Academia Rd, Taipei 11529, Taiwan
COMMENT     PROVISIONAL REFSEQ: This record has not yet been subject to final
            NCBI review. This record is derived from an annotated genomic
            sequence (NC_089401).
            
            On Jun 26, 2024 this sequence version replaced XM_014093812.1.
            COMPLETENESS: incomplete on both ends.
FEATURES             Location/Qualifiers
     source          1..645
                     /organism="Trichoderma atroviride"
                     /mol_type="mRNA"
                     /strain="P1"
                     /db_xref="taxon:63577"
                     /chromosome="2"
     gene            <1..>645
                     /locus_tag="TrAtP1_002718"
                     /old_locus_tag="TRIATDRAFT_269423"
                     /db_xref="GeneID:25779239"
     CDS             1..645
                     /locus_tag="TrAtP1_002718"
                     /old_locus_tag="TRIATDRAFT_269423"
                     /note="antiSMASH:Cluster_2.2"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_013949287.2"
                     /db_xref="GeneID:25779239"
                     /translation="
MQPAPEISAESWKKEEMGEPNPVADLVLETLQHAPAMRYKGRKRVQDTLTLIPPARRTTELVGLLCAALRGEMIYWQRLQKIEQSISLESLRSMYIMNVILIVSVLTGLEVRQEEIVPPVPLACPVIEEDYLALDDILVQLQKLKTVDADDQANQIEVQRFRQVLGRLMARVRPGQLFAAMAGHLAQLVRDSAPDDNFDFANPRQVLTDCALYL"
ORIGIN      
atgcagccggcaccagagatatcggccgagtcatggaaaaaagaggagatgggcgaaccaaaccctgtcgcagacttggtcttggagactctgcaacacgcgccagcaatgcgttacaagggtcggaaaagagtgcaagataccctcaccctcatcccgcccgcaaggagaacaacggagcttgtgggtcttctatgcgctgcgcttcggggagagatgatttattggcaacggcttcaaaagattgagcagtccatatcgttggagtctctgagatcaatgtacataatgaatgtcatactcatcgtctcggtcctgacaggactagaagtcaggcaagaagagattgtgccacccgtcccattggcgtgtcctgtgatagaggaggactacttggctttggatgacatactcgtccagctgcaaaagctgaaaacagttgatgccgacgatcaggcaaaccaaattgaagtgcaaagattcaggcaagttttgggtcgcctgatggcccgggtacgcccggggcaattgtttgctgctatggctgggcacctcgcccagcttgtgagagattcagctcccgacgacaacttcgatttcgctaatcctcgtcaagtcctaaccgactgtgccttgtacctttga
//

by @meso_cacase at DBCLS
This page is licensed under a Creative Commons Attribution 4.0 International License (CC BY 4.0).

If you use GGRNA in your work, please cite:
Naito Y, Bono H. (2012)
GGRNA: an ultrafast, transcript-oriented search engine for genes and transcripts.
Nucleic Acids Res., 40, W592-W596. [Full Text]