2025-07-15 15:15:08, GGRNA.v2 : RefSeq release 229 (Mar, 2025)
LOCUS XM_014077977 747 bp mRNA linear PLN 29-DEC-2023 DEFINITION Ogataea parapolymorpha DL-1 Mitochondrial nuclease (HPODL_01466), partial mRNA. ACCESSION XM_014077977 VERSION XM_014077977.1 DBLINK BioProject: PRJNA264114 BioSample: SAMN02981294 KEYWORDS RefSeq. SOURCE Ogataea parapolymorpha DL-1 ORGANISM Ogataea parapolymorpha DL-1 Eukaryota; Fungi; Dikarya; Ascomycota; Saccharomycotina; Pichiomycetes; Pichiales; Pichiaceae; Ogataea. REFERENCE 1 (bases 1 to 747) AUTHORS Ravin,N.V., Mardanov,A.V., Eldarov,M.A., Kadnikov,V.V., Beletsky,A.V., Zvereva,M.I., Smekalova,E.M., Dontsova,O.A. and Skryabin,K.G. TITLE Genome sequence of the methylotrophic yeast Hansenula polymorpha DL1 JOURNAL Unpublished REFERENCE 2 (bases 1 to 747) CONSRTM NCBI Genome Project TITLE Direct Submission JOURNAL Submitted (28-DEC-2023) National Center for Biotechnology Information, NIH, Bethesda, MD 20894, USA REFERENCE 3 (bases 1 to 747) AUTHORS Mardanov,A.V., Kadnikov,V.V. and Beletsky,A.V. TITLE Direct Submission JOURNAL Submitted (25-OCT-2013) Lab of Molecular Cloning, Centre 'Bioengineering' RAS, Prosp. 60-let Oktyabrya, bld. 7-1, Moscow 117312, Russia COMMENT PROVISIONAL REFSEQ: This record has not yet been subject to final NCBI review. This record is derived from an annotated genomic sequence (NC_027861). COMPLETENESS: incomplete on both ends. FEATURES Location/Qualifiers source 1..747 /organism="Ogataea parapolymorpha DL-1" /mol_type="mRNA" /strain="DL-1" /type_material="holotype of Candida parapolymorpha" /db_xref="taxon:871575" /chromosome="VI" /geo_loc_name="Russia: Moscow" gene <1..>747 /locus_tag="HPODL_01466" /db_xref="GeneID:25770927" CDS 1..747 /locus_tag="HPODL_01466" /EC_number="3.1.30.-" /codon_start=1 /product="Mitochondrial nuclease" /protein_id="XP_013933452.1" /db_xref="GeneID:25770927" /db_xref="GO:0003676" /db_xref="GO:0004520" /db_xref="GO:0004529" /db_xref="GO:0004540" /db_xref="GO:0005634" /db_xref="GO:0005743" /db_xref="GO:0006308" /db_xref="GO:0006310" /db_xref="GO:0006401" /db_xref="GO:0006915" /translation="
MEFVSVYDRQKRNPYYVVEHITPESLKRDASGGGDRKNSVFKEDEQIPMKFRGFLRDYFRSGYDRGHQAPAADAKFSQVAMDETFYLTNMSPQVGAGFNRDYWAHFEDFVRRLTTGYGSVRVVTGPLYLPKKDPVDGKYKVTYEVIGNPPNIAVPTHFFKLIVAEKSFKRSPNSDDIAVAAFVMPNAVIPNEVPLTSFEVPVDALERSSGLEFLKMVPDNKKKQLCKEFSCNIIVREFNDTVKALPSE"
misc_feature 4..660 /locus_tag="HPODL_01466" /note="DNA/RNA non-specific endonuclease; Region: NUC; smart00477" /db_xref="CDD:214683" misc_feature order(190..195,199..201,295..297,319..321,331..333) /locus_tag="HPODL_01466" /note="active site" /db_xref="CDD:238043" misc_feature order(190..195,331..333) /locus_tag="HPODL_01466" /note="substrate binding site [chemical binding]; other site" /db_xref="CDD:238043" misc_feature 295..297 /locus_tag="HPODL_01466" /note="Mg2+ binding site [ion binding]; other site" /db_xref="CDD:238043" ORIGIN
atggaattcgtctcggtgtacgaccgtcagaaaagaaatccatattacgtcgtggaacatatcactcccgagtcattgaagcgtgatgcttcggggggaggggaccgtaagaactctgtgttcaaagaagatgagcaaattccaatgaagtttcgcggatttctgcgagattacttcagatcagggtacgacagaggacatcaagctcctgctgcggacgccaaattttcccaagtagccatggacgaaacgttctacctcacaaacatgtctccccaggtaggagccggtttcaacagagactactgggcacactttgaggatttcgtgagaagactaactactggctacggttctgtcagagtcgttactggcccgttgtaccttcctaaaaaagaccctgttgacggaaaatacaaggtcacgtacgaggttattggcaatccaccaaatattgctgttcccacgcactttttcaagctgatcgtggcagaaaagtcgtttaaaagaagtcccaactctgacgatattgcagttgcggccttcgtgatgcccaatgctgtcatccctaatgaggttcctctcacttcttttgaagtgcctgttgatgcactagagcgctcttcgggcctggaattcctgaaaatggtgcctgataacaagaaaaaacaactgtgcaaagaatttagctgtaacattatcgtgcgagagttcaacgataccgtcaaagctctaccatctgaataa
//
by
@meso_cacase at
DBCLS
This page is licensed under a
Creative Commons Attribution 4.0 International License (CC BY 4.0).
If you use GGRNA in your work, please cite:
Naito Y, Bono H. (2012)
GGRNA: an ultrafast, transcript-oriented search engine for genes and transcripts.
Nucleic Acids Res., 40, W592-W596.
[Full Text]