LOCUS       XM_012975290            1153 bp    mRNA    linear   PLN 24-JUN-2015
DEFINITION  PREDICTED: Erythranthe guttatus uncharacterized LOC105951830
            (LOC105951830), mRNA.
ACCESSION   XM_012975290
VERSION     XM_012975290.1
DBLINK      BioProject: PRJNA285087
KEYWORDS    RefSeq; includes ab initio.
SOURCE      Erythranthe guttata (spotted monkey flower)
  ORGANISM  Erythranthe guttata
            Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta;
            Spermatophyta; Magnoliopsida; eudicotyledons; Gunneridae;
            Pentapetalae; asterids; lamiids; Lamiales; Phrymaceae; Erythranthe.
COMMENT     MODEL REFSEQ:  This record is predicted by automated computational
            analysis. This record is derived from a genomic sequence
            (NW_012192934.1) annotated using gene prediction method: Gnomon.
            Also see:
                Documentation of NCBI's Annotation Process
            
            ##Genome-Annotation-Data-START##
            Annotation Provider         :: NCBI
            Annotation Status           :: Full annotation
            Annotation Version          :: Erythranthe guttata Annotation
                                           Release 100
            Annotation Pipeline         :: NCBI eukaryotic genome annotation
                                           pipeline
            Annotation Software Version :: 6.3
            Annotation Method           :: Best-placed RefSeq; Gnomon
            Features Annotated          :: Gene; mRNA; CDS; ncRNA
            ##Genome-Annotation-Data-END##
            
            ##RefSeq-Attributes-START##
            ab initio :: 55% of CDS bases
            ##RefSeq-Attributes-END##
FEATURES             Location/Qualifiers
     source          1..1153
                     /organism="Erythranthe guttata"
                     /mol_type="mRNA"
                     /cultivar="IM62"
                     /db_xref="taxon:4155"
                     /chromosome="Unknown"
     gene            1..1153
                     /gene="LOC105951830"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Gnomon. Supporting evidence
                     includes similarity to: 57% coverage of the annotated
                     genomic feature by RNAseq alignments"
                     /db_xref="GeneID:105951830"
     CDS             263..1153
                     /gene="LOC105951830"
                     /codon_start=1
                     /product="uncharacterized protein LOC105951830"
                     /protein_id="XP_012830744.1"
                     /db_xref="GeneID:105951830"
                     /translation="

MRDMDADRVRNYLEDQFLGFTSVPLSDIVSDESGNSPREFDLSSSEIMHSHAGFVELSFNYSGIISHESHSVSVADVAHEQNVSCDLDRIEFPDQETVNENERTVSEHLRFPCDELDPQVQGGSCPLENDDNDLSLKGGGSCPLRNGDNNLSSKGGYFPLENDDNSLRSEGGSCPLSCIEVSSLETGDAEKRDDHKGGGGDGGEGVSGILPLVVSDETKETVVQEEIVDMYMKGMQQFTDALAKMKLPMDTGDGSKVETDDAKMENNQAGPNGKIQGSKSPDLSSPRVFYGSGAFF"

ORIGIN      

gttgcagcagtgtcgcaatggttgatgatggtagtaagaataactcggacgagttcattggatttgtcgaggtttgcatacatcaggcaagagagatacacaacatatgtatatatcaaaaccaggatgtctacgccaaattctgctccaccgataatcccgagtcgaaaatctcgaccaaggttatcaaccaaggtggcagaaatcccgttttcaacaaaaccttgaatctaagtttccgaaaactcgattcatccctaagatgcgagatatggatgctgatcgagtccgaaactatctcgaagatcaattccttggatttacgtcagtgcccctttctgatatcgtatcggacgagagtgggaattcgccacgagagttcgacttgtcctcgagcgaaattatgcattctcatgcgggttttgtcgaattgtcttttaactactctggaataatatctcacgagtctcattctgtatcggtggctgatgtggctcatgagcaaaatgtttcgtgtgatctcgataggatcgaattccccgatcaagaaactgtgaatgaaaacgaaagaacagtttcggagcacttgagattcccgtgtgacgagcttgacccccaggttcaggggggttcttgccccctagaaaatgacgataatgacctcagtttgaaaggggggggttcttgccccctcagaaatggcgataataacctcagttcaaaagggggttatttcccccttgagaatgacgataatagcctccgttcggaagggggttcttgccccctttcatgtattgaggttagttcactagaaacgggagatgcggaaaaacgagatgatcataagggaggtggtggagacgggggagagggtgtttcaggtattttgcctcttgtcgttagcgatgaaacaaaagagacggtggtgcaagaagagattgtggatatgtacatgaaaggtatgcagcaatttacggatgctttggcgaaaatgaagctaccgatggatactggagatggatcgaaagttgaaacggatgatgccaaaatggaaaataatcaggcgggcccgaatgggaaaatacagggatcgaaaagcccggatcttagtagcccgagggtgttttacggcagtggagctttcttttga

//