2025-07-04 02:10:16, GGRNA.v2 : RefSeq release 229 (Mar, 2025)
LOCUS XM_010364917 983 bp mRNA linear PRI 25-SEP-2019 DEFINITION PREDICTED: Rhinopithecus roxellana claudin 17 (CLDN17), mRNA. ACCESSION XM_010364917 VERSION XM_010364917.2 DBLINK BioProject: PRJNA565017 KEYWORDS RefSeq. SOURCE Rhinopithecus roxellana (golden snub-nosed monkey) ORGANISM Rhinopithecus roxellana Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Cercopithecidae; Colobinae; Rhinopithecus. COMMENT MODEL REFSEQ: This record is predicted by automated computational analysis. This record is derived from a genomic sequence (NC_044561.1) annotated using gene prediction method: Gnomon, supported by mRNA evidence. Also see: Documentation of NCBI's Annotation Process On Sep 25, 2019 this sequence version replaced XM_010364917.1. ##Genome-Annotation-Data-START## Annotation Provider :: NCBI Annotation Status :: Full annotation Annotation Name :: Rhinopithecus roxellana Annotation Release 101 Annotation Version :: 101 Annotation Pipeline :: NCBI eukaryotic genome annotation pipeline Annotation Software Version :: 8.2 Annotation Method :: Best-placed RefSeq; Gnomon Features Annotated :: Gene; mRNA; CDS; ncRNA ##Genome-Annotation-Data-END## FEATURES Location/Qualifiers source 1..983 /organism="Rhinopithecus roxellana" /mol_type="mRNA" /isolate="Shanxi Qingling" /db_xref="taxon:61622" /chromosome="13" /sex="male" /tissue_type="heart" /dev_stage="adult" gene 1..983 /gene="CLDN17" /note="Derived by automated computational analysis using gene prediction method: Gnomon. Supporting evidence includes similarity to: 2 mRNAs, 2 Proteins, and 100% coverage of the annotated genomic feature by RNAseq alignments, including 1 sample with support for all annotated introns" /db_xref="GeneID:104663641" CDS 195..869 /gene="CLDN17" /codon_start=1 /product="claudin-17" /protein_id="XP_010363219.2" /db_xref="GeneID:104663641" /translation="
MAFYPLQIAGLVLGFLGMVGTLATTLLPQWRLSAFVGSNIIVFERLWEGLWMNCIRQARVRLQCKFYSSLLALPPVLETARALMCVAVALSLIALLIGICGMKQVQCTGSNERAKAYLLGTSGVLFILTGIFVLIPVSWTANIIIRDFYNPAVHIGQKRELGVALFLGWASAAVLFIGGGLLCGFCCCNRKKQRYRYPVPGHCVPHTDKRRNVTMPSNTSTSYV"
misc_feature 210..740 /gene="CLDN17" /note="PMP-22/EMP/MP20/Claudin family; Region: PMP22_Claudin; cl21598" /db_xref="CDD:473919" ORIGIN
gcaacatgcatttacaacaggtacttctagttaggccaagttcagtcacagccactgatttggactaaaatgatatgggcagcagccaaggagaacatcatcaaagacttctctagactcaagagccttccacgttctacatcttgagcatcttctaccactctgaattggactagtcttcaaagtaaaagacaatggcattttatcccttgcaaattgctgggctggttcttgggttccttggcatggtggggactcttgccacaacgcttctgcctcagtggagactatccgcttttgttggcagcaacattattgtctttgagaggctctgggaagggctctggatgaactgcatccgacaagccagggtccggttgcaatgcaagttctatagttcattgttggctcttccgcctgtcctggaaacagcccgggcacttatgtgtgtggctgttgctctttccttgatcgccctacttattggcatctgtggcatgaagcaggtccagtgcacaggctctaatgagagggccaaagcataccttctgggaacttcaggagtcctcttcatcctgacgggcatcttcgttctgattccagtgagctggacagccaatataatcatcagagatttctacaacccagctgtccacataggtcagaaacgagagctgggagtagcacttttccttggctgggcaagcgctgctgtcctcttcattggagggggtctgctttgtggattttgctgctgcaacagaaagaagcaaaggtacagatatccagtgcctggccactgtgtgccacacacagataagcgaagaaacgtgacaatgcctagtaatacctccaccagttatgtctaatgcctgcttttggctccaagtgtggactatggtcaatgtttgttataaagtcctgctagaaactatacaactgaaaatcatcctgaaatgggggcttctcagcagaatccaagg
//
by
@meso_cacase at
DBCLS
This page is licensed under a
Creative Commons Attribution 4.0 International License (CC BY 4.0).
If you use GGRNA in your work, please cite:
Naito Y, Bono H. (2012)
GGRNA: an ultrafast, transcript-oriented search engine for genes and transcripts.
Nucleic Acids Res., 40, W592-W596.
[Full Text]