LOCUS       XM_009852508             354 bp    mRNA    linear   PLN 29-DEC-2023
DEFINITION  Neurospora tetrasperma FGSC 2508 uncharacterized protein
            (NEUTE1DRAFT_100613), partial mRNA.
ACCESSION   XM_009852508
VERSION     XM_009852508.1
DBLINK      BioProject: PRJNA264105
            BioSample: SAMN02769628
KEYWORDS    RefSeq.
SOURCE      Neurospora tetrasperma FGSC 2508
  ORGANISM  Neurospora tetrasperma FGSC 2508
            Eukaryota; Fungi; Dikarya; Ascomycota; Pezizomycotina;
            Sordariomycetes; Sordariomycetidae; Sordariales; Sordariaceae;
            Neurospora.
REFERENCE   1  (bases 1 to 354)
  AUTHORS   Ellison,C.E., Stajich,J.E., Jacobson,D.J., Lindquist,E.,
            Lapidus,A., Foster,B., Aerts,A., Riley,R., Grigoriev,I.V. and
            Taylor,J.W.
  CONSRTM   US DOE Joint Genome Institute (JGI-PGF)
  TITLE     Massive changes in genome architecture accompany the transition to
            self-fertility in the filamentous fungus Neurospora tetrasperma
  JOURNAL   Unpublished
REFERENCE   2  (bases 1 to 354)
  CONSRTM   NCBI Genome Project
  TITLE     Direct Submission
  JOURNAL   Submitted (28-DEC-2023) National Center for Biotechnology
            Information, NIH, Bethesda, MD 20894, USA
REFERENCE   3  (bases 1 to 354)
  AUTHORS   Aerts,A., Ellison,C.E., Stajich,J.E., Jacobson,D.J., Schmutz,J.,
            Lapidus,A., Foster,B., Pitluck,S., Riley,R., Lindquist,E.,
            Lucas,S., Taylor,J.W. and Grigoriev,I.V.
  CONSRTM   US DOE Joint Genome Institute (JGI-PGF)
  TITLE     Direct Submission
  JOURNAL   Submitted (06-APR-2011) US DOE Joint Genome Institute, 2800
            Mitchell Drive, Walnut Creek, CA 94598-1698, USA
COMMENT     PROVISIONAL REFSEQ: This record has not yet been subject to final
            NCBI review. This record is derived from an annotated genomic
            sequence (NW_009799101).
            
            ##Metadata-START##
            Organism Display Name :: Neurospora tetrasperma FGSC 2508
            GOLD Stamp ID         :: Gi01602
            ##Metadata-END##
            COMPLETENESS: incomplete on both ends.
FEATURES             Location/Qualifiers
     source          1..354
                     /organism="Neurospora tetrasperma FGSC 2508"
                     /mol_type="mRNA"
                     /strain="FGSC 2508"
                     /db_xref="taxon:510951"
                     /chromosome="Unknown"
                     /mating_type="mat A"
     gene            <1..>354
                     /locus_tag="NEUTE1DRAFT_100613"
                     /db_xref="GeneID:20821680"
     CDS             1..354
                     /locus_tag="NEUTE1DRAFT_100613"
                     /note="conserved hypothetical protein"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_009850810.1"
                     /db_xref="GeneID:20821680"
                     /db_xref="JGIDB:Neute_matA2_100613"
                     /translation="

MLRFSFPGESALQSIKMEEASGCNERDFEYTSADKRDVCTESVMPARRDCVGDGFYQTKFSAQKSEALKCVRVMRMDHGTENNFPGTRPMWRSRLILPLADLVMYVHRYLGFTGHFS"

ORIGIN      

atgcttcgtttctcgtttcccggcgagtccgcattgcaatccatcaagatggaggaagcctctggttgcaacgagcgtgattttgaatacacatctgccgacaaacgagatgtttgcacagagtcggtgatgcctgcaagaagagattgtgtgggcgatggcttctatcaaaccaaattctctgcacaaaagagcgaggcgctgaagtgcgtccgtgtgatgagaatggatcatggaacagagaacaacttccccgggacccggcccatgtggagatctcggctcattcttccgttggctgatcttgttatgtatgtacatcgctatttggggtttacaggccatttcagctga

//