GGRNA ver.2 Home | Help | Advanced search    Previous release (v1)

2024-05-04 23:46:21, GGRNA.v2 : RefSeq release 222 (Jan, 2024)

LOCUS       XM_009490835             356 bp    mRNA    linear   VRT 06-OCT-2014
DEFINITION  PREDICTED: Pelecanus crispus VCP-interacting membrane protein
            (VIMP), partial mRNA.
ACCESSION   XM_009490835
VERSION     XM_009490835.1
DBLINK      BioProject: PRJNA253833
KEYWORDS    RefSeq; includes ab initio.
SOURCE      Pelecanus crispus (Dalmatian pelican)
  ORGANISM  Pelecanus crispus
            Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
            Archelosauria; Archosauria; Dinosauria; Saurischia; Theropoda;
            Coelurosauria; Aves; Neognathae; Pelecaniformes; Pelecanidae;
            Pelecanus.
COMMENT     MODEL REFSEQ:  This record is predicted by automated computational
            analysis. This record is derived from a genomic sequence
            (NW_009110707.1) annotated using gene prediction method: Gnomon.
            Also see:
                Documentation of NCBI's Annotation Process
            
            ##Genome-Annotation-Data-START##
            Annotation Provider         :: NCBI
            Annotation Status           :: Full annotation
            Annotation Version          :: Pelecanus crispus Annotation Release
                                           100
            Annotation Pipeline         :: NCBI eukaryotic genome annotation
                                           pipeline
            Annotation Software Version :: 6.1
            Annotation Method           :: Best-placed RefSeq; Gnomon
            Features Annotated          :: Gene; mRNA; CDS; ncRNA
            ##Genome-Annotation-Data-END##
            
            ##RefSeq-Attributes-START##
            ab initio :: 1% of CDS bases
            ##RefSeq-Attributes-END##
            COMPLETENESS: incomplete on the 5' end.
FEATURES             Location/Qualifiers
     source          1..356
                     /organism="Pelecanus crispus"
                     /mol_type="mRNA"
                     /isolate="BGI_N334"
                     /db_xref="taxon:36300"
                     /chromosome="Unknown"
                     /sex="male"
     gene            <1..356
                     /gene="VIMP"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Gnomon. Supporting evidence
                     includes similarity to: 5 Proteins"
                     /db_xref="GeneID:104037034"
     CDS             <1..356
                     /gene="VIMP"
                     /codon_start=3
                     /product="selenoprotein S"
                     /protein_id="XP_009489110.1"
                     /db_xref="GeneID:104037034"
                     /translation="
PDVVVRRQEALAAARLRMQEELNAQAERYKEKQRQLEEEKRRQKIAMWESMQEGKSYKGNLKLNQQEVESGASTSSAVPKSKPNKKPLRGGGYNPLSGEGGGTCSWRPGRRGPSAGG"
     misc_feature    <1..353
                     /gene="VIMP"
                     /note="Selenoprotein S (SelS); Region: Selenoprotein_S;
                     pfam06936"
                     /db_xref="CDD:429198"
ORIGIN      
aacctgacgtggtggtaagaaggcaggaagctttggcagcagctcgcctcaggatgcaagaggagttgaatgcacaagcagaaagatacaaagaaaaacaaagacagcttgaagaagagaagcgaaggcagaagatagcaatgtgggaaagtatgcaagaaggaaaaagctataaaggaaacctgaaactgaaccagcaagaagtagaatctggtgcctccacctcatcagcagtcccgaaatctaaaccaaacaaaaagcccttgcgaggcggtggctataaccccctgtctggagaaggaggcggaacttgttcctggagaccaggccggagaggcccgtcagcaggcggatga
//

by @meso_cacase at DBCLS
This page is licensed under a Creative Commons Attribution 4.0 International License (CC BY 4.0).

If you use GGRNA in your work, please cite:
Naito Y, Bono H. (2012)
GGRNA: an ultrafast, transcript-oriented search engine for genes and transcripts.
Nucleic Acids Res., 40, W592-W596. [Full Text]