GGRNA ver.2 Home | Help | Advanced search    Previous release (v1)

2025-12-09 09:59:58, GGRNA.v2 : RefSeq release 232 (Sep, 2025)

LOCUS       XM_009287747            1281 bp    mRNA    linear   VRT 05-DEC-2016
DEFINITION  PREDICTED: Aptenodytes forsteri homeobox B8 (HOXB8), transcript
            variant X1, mRNA.
ACCESSION   XM_009287747
VERSION     XM_009287747.1
DBLINK      BioProject: PRJNA261081
KEYWORDS    RefSeq.
SOURCE      Aptenodytes forsteri (emperor penguin)
  ORGANISM  Aptenodytes forsteri
            Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
            Archelosauria; Archosauria; Dinosauria; Saurischia; Theropoda;
            Coelurosauria; Aves; Neognathae; Neoaves; Aequornithes;
            Sphenisciformes; Spheniscidae; Aptenodytes.
COMMENT     MODEL REFSEQ:  This record is predicted by automated computational
            analysis. This record is derived from a genomic sequence
            (NW_008796180.1) annotated using gene prediction method: Gnomon.
            Also see:
                Documentation of NCBI's Annotation Process
            
            ##Genome-Annotation-Data-START##
            Annotation Provider         :: NCBI
            Annotation Status           :: Full annotation
            Annotation Version          :: Aptenodytes forsteri Annotation
                                           Release 101
            Annotation Pipeline         :: NCBI eukaryotic genome annotation
                                           pipeline
            Annotation Software Version :: 7.2
            Annotation Method           :: Best-placed RefSeq; Gnomon
            Features Annotated          :: Gene; mRNA; CDS; ncRNA
            ##Genome-Annotation-Data-END##
FEATURES             Location/Qualifiers
     source          1..1281
                     /organism="Aptenodytes forsteri"
                     /mol_type="mRNA"
                     /isolate="BGI_AS27"
                     /db_xref="taxon:9233"
                     /chromosome="Unknown"
                     /sex="male"
                     /geo_loc_name="Antarctica"
     gene            1..1281
                     /gene="HOXB8"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Gnomon. Supporting evidence
                     includes similarity to: 12 Proteins, and 65% coverage of
                     the annotated genomic feature by RNAseq alignments"
                     /db_xref="GeneID:103905941"
     CDS             1..729
                     /gene="HOXB8"
                     /codon_start=1
                     /product="homeobox protein Hox-B8 isoform X1"
                     /protein_id="XP_009286022.1"
                     /db_xref="GeneID:103905941"
                     /translation="
MSSYFVNSLFSKYKTGDSLRPNYYDCGFAQDLGGRPTVVYGPSTGGTFQHPTQIQEFYHGASSLSSSPYQQNPCAVACHGDPSNFYGYDPLQRQSLFSAQESDLVQYTDCKLAASGLGEEAESSEQSPSPTQLFPWMRPQAAAGRRRGGETYSRYQTLELEKEFLFNPYLTRKRRIEVSHALGLTERQVKIWFQNRRMKWKKENNKDKFPSSKCEQEELEKQKMERAQEVDEEGEAQKADKK"
     misc_feature    451..606
                     /gene="HOXB8"
                     /note="Region: Homeodomain; pfam00046"
                     /db_xref="CDD:459649"
ORIGIN      
atgagctcttattttgtcaactcactcttctccaaatacaaaaccggggactccttgcgtcccaattactatgactgcgggttcgctcaggatcttgggggcagacccacggtggtgtacggacccagcacggggggcaccttccagcatccgacccaaatccaggagttttaccacggagcatcctcactctccagctccccttaccaacagaatccctgcgccgtggcgtgccatggggaccccagcaacttctatggctacgaccccttgcaaaggcagagcctcttcagcgcccaggagtcggacttggtgcagtacacggactgcaagcttgctgccagcggccttggagaggaggcggagagctcggagcagagcccttctccgacccagcttttcccctggatgcgaccgcaagcagccgctggacggaggagggggggggaaacctacagccgctaccagacgctggaactggagaaggaatttctatttaatccctacctgacccgcaaacggaggatcgaggtctcgcatgccctgggattgacagaaaggcaggtcaaaatctggttccagaacaggaggatgaaatggaaaaaggaaaacaacaaagacaagtttcccagcagcaaatgcgagcaggaagaactggaaaaacagaaaatggaaagagcccaggaggtggacgaggaaggggaagcacagaaggcggacaagaaataaaaggatttttaaggactgaaaggcaagcgctgctggggtggaagagcccctgagccccacgttaatggcagttaatgtaagggaggggtgggaaaaaaaccaacaatgcatagaaaagagaaaggaaaaaaaaaaaaaacccttttattgctgtaaaacaatatagctgtaagcaccactttcctgattatcctttgatacaatgaacagtatgcaaaagtgatcgggaggtctctcctgccttttgccagttattaactagtggtagtgtaacgcaatagcttatgtaaaacatgactgtgaaattctctctctctctctgtctttctctctgtctctctcttctgtcctggggggtgggttggttaacatagctttcaatgctataggagttacgtgaaattacatttgtgcactttttttttttaattttccacctttttggttgtggtttatctgtatgtactggaggtagctattgaaacaaacatcccaacaacatgaaactgcctatttatgcaatagttatctctccctttctctctctttctc
//

by @meso_cacase at DBCLS
This page is licensed under a Creative Commons Attribution 4.0 International License (CC BY 4.0).

If you use GGRNA in your work, please cite:
Naito Y, Bono H. (2012)
GGRNA: an ultrafast, transcript-oriented search engine for genes and transcripts.
Nucleic Acids Res., 40, W592-W596. [Full Text]