2025-07-03 09:19:42, GGRNA.v2 : RefSeq release 229 (Mar, 2025)
LOCUS XM_006838959 525 bp mRNA linear PLN 04-APR-2017 DEFINITION PREDICTED: Amborella trichopoda F-box/kelch-repeat protein SKIP30 (LOC18429676), mRNA. ACCESSION XM_006838959 VERSION XM_006838959.1 DBLINK BioProject: PRJNA238126 KEYWORDS RefSeq; includes ab initio. SOURCE Amborella trichopoda ORGANISM Amborella trichopoda Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta; Spermatophyta; Magnoliopsida; Amborellales; Amborellaceae; Amborella. COMMENT MODEL REFSEQ: This record is predicted by automated computational analysis. This record is derived from a genomic sequence (NW_006497648.1) annotated using gene prediction method: Gnomon. Also see: Documentation of NCBI's Annotation Process ##Genome-Annotation-Data-START## Annotation Provider :: NCBI Annotation Status :: Full annotation Annotation Version :: Amborella trichopoda Annotation Release 101 Annotation Pipeline :: NCBI eukaryotic genome annotation pipeline Annotation Software Version :: 7.3 Annotation Method :: Best-placed RefSeq; Gnomon Features Annotated :: Gene; mRNA; CDS; ncRNA ##Genome-Annotation-Data-END## ##RefSeq-Attributes-START## ab initio :: 100% of CDS bases ##RefSeq-Attributes-END## FEATURES Location/Qualifiers source 1..525 /organism="Amborella trichopoda" /mol_type="mRNA" /db_xref="taxon:13333" /chromosome="Unknown" /tissue_type="leaf" /geo_loc_name="USA: California; University of California Santa Cruz Arboretum" /lat_lon="36.983 N 122.060 W" /collection_date="2001" gene 1..525 /gene="LOC18429676" /note="Derived by automated computational analysis using gene prediction method: Gnomon. Supporting evidence includes similarity to: 4 Proteins" /db_xref="GeneID:18429676" CDS 1..525 /gene="LOC18429676" /codon_start=1 /product="F-box/kelch-repeat protein SKIP30" /protein_id="XP_006839022.1" /db_xref="GeneID:18429676" /translation="
MCLARVPFSSYPTLCLVSHSWRDAIQSPDLFKMRIEVNSTEDFLCVFAAQRENLWQLYDPSRDIWMSLPPLPTTIHRIRWFCTSSEHPLDPLTGGSEHPLDPLTGEIGPPVVTNEVWCYNPAWRQWAQHSPMRSPRHSFACCAWEGRILIAGGFTTGEVEINAAEVYDPVLDVW"
misc_feature <4..102 /gene="LOC18429676" /note="F-box domain superfamily; Region: F-box_SF; cl45894" /db_xref="CDD:459239" misc_feature 157..>522 /gene="LOC18429676" /note="N-acetylneuraminic acid mutarotase [Cell wall/membrane/envelope biogenesis]; Region: NanM; COG3055" /db_xref="CDD:442289" misc_feature 235..399 /gene="LOC18429676" /note="KELCH repeat [structural motif]; Region: KELCH repeat" /db_xref="CDD:276965" ORIGIN
atgtgcctggctcgtgtgccattctcttcatacccaaccctttgcctcgtctcccactcatggcgggatgcgatacagagcccagacctcttcaagatgcggatcgaagtaaactccactgaggatttcctatgtgttttcgccgcgcaacgtgaaaacctttggcagctctatgacccctcgagagatatctggatgagcctgcccccactcccaacaactatccatagaattagatggttctgtacctcaagtgaacatcctttggacccactaactgggggaagtgaacatcctttggacccactaactggggaaatcggaccccctgtagtgacgaacgaggtgtggtgttacaacccagcatggcgccagtgggcccagcactcacctatgcgatctccacgtcactcgttcgcttgttgtgcttgggagggccggatactcatcgcagggggcttcactacaggagaggtggagatcaatgcagcagaggtttacgaccccgtgcttgatgtgtggtag
//
by
@meso_cacase at
DBCLS
This page is licensed under a
Creative Commons Attribution 4.0 International License (CC BY 4.0).
If you use GGRNA in your work, please cite:
Naito Y, Bono H. (2012)
GGRNA: an ultrafast, transcript-oriented search engine for genes and transcripts.
Nucleic Acids Res., 40, W592-W596.
[Full Text]