GGRNA ver.2 Home | Help | Advanced search    Previous release (v1)

2025-07-03 09:19:42, GGRNA.v2 : RefSeq release 229 (Mar, 2025)

LOCUS       XM_006838959             525 bp    mRNA    linear   PLN 04-APR-2017
DEFINITION  PREDICTED: Amborella trichopoda F-box/kelch-repeat protein SKIP30
            (LOC18429676), mRNA.
ACCESSION   XM_006838959
VERSION     XM_006838959.1
DBLINK      BioProject: PRJNA238126
KEYWORDS    RefSeq; includes ab initio.
SOURCE      Amborella trichopoda
  ORGANISM  Amborella trichopoda
            Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta;
            Spermatophyta; Magnoliopsida; Amborellales; Amborellaceae;
            Amborella.
COMMENT     MODEL REFSEQ:  This record is predicted by automated computational
            analysis. This record is derived from a genomic sequence
            (NW_006497648.1) annotated using gene prediction method: Gnomon.
            Also see:
                Documentation of NCBI's Annotation Process
            
            ##Genome-Annotation-Data-START##
            Annotation Provider         :: NCBI
            Annotation Status           :: Full annotation
            Annotation Version          :: Amborella trichopoda Annotation
                                           Release 101
            Annotation Pipeline         :: NCBI eukaryotic genome annotation
                                           pipeline
            Annotation Software Version :: 7.3
            Annotation Method           :: Best-placed RefSeq; Gnomon
            Features Annotated          :: Gene; mRNA; CDS; ncRNA
            ##Genome-Annotation-Data-END##
            
            ##RefSeq-Attributes-START##
            ab initio :: 100% of CDS bases
            ##RefSeq-Attributes-END##
FEATURES             Location/Qualifiers
     source          1..525
                     /organism="Amborella trichopoda"
                     /mol_type="mRNA"
                     /db_xref="taxon:13333"
                     /chromosome="Unknown"
                     /tissue_type="leaf"
                     /geo_loc_name="USA: California; University of California
                     Santa Cruz Arboretum"
                     /lat_lon="36.983 N 122.060 W"
                     /collection_date="2001"
     gene            1..525
                     /gene="LOC18429676"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Gnomon. Supporting evidence
                     includes similarity to: 4 Proteins"
                     /db_xref="GeneID:18429676"
     CDS             1..525
                     /gene="LOC18429676"
                     /codon_start=1
                     /product="F-box/kelch-repeat protein SKIP30"
                     /protein_id="XP_006839022.1"
                     /db_xref="GeneID:18429676"
                     /translation="
MCLARVPFSSYPTLCLVSHSWRDAIQSPDLFKMRIEVNSTEDFLCVFAAQRENLWQLYDPSRDIWMSLPPLPTTIHRIRWFCTSSEHPLDPLTGGSEHPLDPLTGEIGPPVVTNEVWCYNPAWRQWAQHSPMRSPRHSFACCAWEGRILIAGGFTTGEVEINAAEVYDPVLDVW"
     misc_feature    <4..102
                     /gene="LOC18429676"
                     /note="F-box domain superfamily; Region: F-box_SF;
                     cl45894"
                     /db_xref="CDD:459239"
     misc_feature    157..>522
                     /gene="LOC18429676"
                     /note="N-acetylneuraminic acid mutarotase [Cell
                     wall/membrane/envelope biogenesis]; Region: NanM; COG3055"
                     /db_xref="CDD:442289"
     misc_feature    235..399
                     /gene="LOC18429676"
                     /note="KELCH repeat [structural motif]; Region: KELCH
                     repeat"
                     /db_xref="CDD:276965"
ORIGIN      
atgtgcctggctcgtgtgccattctcttcatacccaaccctttgcctcgtctcccactcatggcgggatgcgatacagagcccagacctcttcaagatgcggatcgaagtaaactccactgaggatttcctatgtgttttcgccgcgcaacgtgaaaacctttggcagctctatgacccctcgagagatatctggatgagcctgcccccactcccaacaactatccatagaattagatggttctgtacctcaagtgaacatcctttggacccactaactgggggaagtgaacatcctttggacccactaactggggaaatcggaccccctgtagtgacgaacgaggtgtggtgttacaacccagcatggcgccagtgggcccagcactcacctatgcgatctccacgtcactcgttcgcttgttgtgcttgggagggccggatactcatcgcagggggcttcactacaggagaggtggagatcaatgcagcagaggtttacgaccccgtgcttgatgtgtggtag
//

by @meso_cacase at DBCLS
This page is licensed under a Creative Commons Attribution 4.0 International License (CC BY 4.0).

If you use GGRNA in your work, please cite:
Naito Y, Bono H. (2012)
GGRNA: an ultrafast, transcript-oriented search engine for genes and transcripts.
Nucleic Acids Res., 40, W592-W596. [Full Text]