2024-04-20 23:04:55, GGRNA.v2 : RefSeq release 222 (Jan, 2024)
LOCUS XM_005515875 455 bp mRNA linear VRT 24-MAY-2017 DEFINITION PREDICTED: Columba livia cytochrome P450 2C31 (LOC102094641), partial mRNA. ACCESSION XM_005515875 VERSION XM_005515875.3 DBLINK BioProject: PRJNA217047 KEYWORDS RefSeq; includes ab initio. SOURCE Columba livia (rock pigeon) ORGANISM Columba livia Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Archelosauria; Archosauria; Dinosauria; Saurischia; Theropoda; Coelurosauria; Aves; Neognathae; Columbiformes; Columbidae; Columba. COMMENT MODEL REFSEQ: This record is predicted by automated computational analysis. This record is derived from a genomic sequence (NW_004987673.1) annotated using gene prediction method: Gnomon. Also see: Documentation of NCBI's Annotation Process On May 24, 2017 this sequence version replaced XM_005515875.2. ##Genome-Annotation-Data-START## Annotation Provider :: NCBI Annotation Status :: Full annotation Annotation Version :: Columba livia Annotation Release 102 Annotation Pipeline :: NCBI eukaryotic genome annotation pipeline Annotation Software Version :: 7.4 Annotation Method :: Best-placed RefSeq; Gnomon Features Annotated :: Gene; mRNA; CDS; ncRNA ##Genome-Annotation-Data-END## ##RefSeq-Attributes-START## ab initio :: 2% of CDS bases ##RefSeq-Attributes-END## COMPLETENESS: incomplete on the 3' end. FEATURES Location/Qualifiers source 1..455 /organism="Columba livia" /mol_type="mRNA" /db_xref="taxon:8932" /chromosome="Unknown" /sex="male" /tissue_type="blood" /country="Denmark: Vordingborg" /collection_date="13-Jun-2010" /breed="Danish Tumbler" /note="bred by Anders Christiansen, Hans Ove Christiansen, and certified by Danmarks Racedueforeninger" gene 1..>455 /gene="LOC102094641" /note="Derived by automated computational analysis using gene prediction method: Gnomon. Supporting evidence includes similarity to: 7 Proteins, and 97% coverage of the annotated genomic feature by RNAseq alignments, including 8 samples with support for all annotated introns" /db_xref="GeneID:102094641" CDS 1..>455 /gene="LOC102094641" /codon_start=1 /product="cytochrome P450 2C31" /protein_id="XP_005515932.1" /db_xref="GeneID:102094641" /translation="
MLWTFLFLSFQLYQMFSKILDYLPGPHNRVFAEIDALKAFVSEEMKMHKGSLDPSSPQDYIDCFLCKMQKEKKNPNSSFHMENLITSTFDLFIAGSETTSTTIRYGLLLLLKYPKIQEKVQEEIDQVVGRSRRPCVADRSQMPYTDAVLHE"
misc_feature <10..>455 /gene="LOC102094641" /note="cytochrome P450 (CYP) superfamily; Region: cytochrome_P450; cl41757" /db_xref="CDD:425388" ORIGIN
atgctatggaccttcctgtttctttccttccagctctaccagatgttctcaaagatcctggattacttgcctggcccacacaacagagtgtttgcagaaatcgatgctctaaaagcctttgtgtcagaagagatgaagatgcacaaaggctccctagatcctagctcccctcaggattacattgactgcttcctctgcaaaatgcagaaggagaaaaagaatcccaactccagtttccacatggagaacctgataaccagcacctttgacttgttcattgccggatctgagacaactagcaccaccataagatatggacttctgcttcttctcaaatacccaaagatacaagagaaagttcaagaagagattgaccaggtagtgggacgatcacgaagaccttgtgtggctgaccggtcccagatgccctacacagatgcagtgctccatgaaat
//
by
@meso_cacase at
DBCLS
This page is licensed under a
Creative Commons Attribution 4.0 International License (CC BY 4.0).
If you use GGRNA in your work, please cite:
Naito Y, Bono H. (2012)
GGRNA: an ultrafast, transcript-oriented search engine for genes and transcripts.
Nucleic Acids Res., 40, W592-W596.
[Full Text]