LOCUS       XM_005515875             455 bp    mRNA    linear   VRT 24-MAY-2017
DEFINITION  PREDICTED: Columba livia cytochrome P450 2C31 (LOC102094641),
            partial mRNA.
ACCESSION   XM_005515875
VERSION     XM_005515875.3
DBLINK      BioProject: PRJNA217047
KEYWORDS    RefSeq; includes ab initio.
SOURCE      Columba livia (rock pigeon)
  ORGANISM  Columba livia
            Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
            Archelosauria; Archosauria; Dinosauria; Saurischia; Theropoda;
            Coelurosauria; Aves; Neognathae; Columbiformes; Columbidae;
            Columba.
COMMENT     MODEL REFSEQ:  This record is predicted by automated computational
            analysis. This record is derived from a genomic sequence
            (NW_004987673.1) annotated using gene prediction method: Gnomon.
            Also see:
                Documentation of NCBI's Annotation Process
            
            On May 24, 2017 this sequence version replaced XM_005515875.2.
            
            ##Genome-Annotation-Data-START##
            Annotation Provider         :: NCBI
            Annotation Status           :: Full annotation
            Annotation Version          :: Columba livia Annotation Release 102
            Annotation Pipeline         :: NCBI eukaryotic genome annotation
                                           pipeline
            Annotation Software Version :: 7.4
            Annotation Method           :: Best-placed RefSeq; Gnomon
            Features Annotated          :: Gene; mRNA; CDS; ncRNA
            ##Genome-Annotation-Data-END##
            
            ##RefSeq-Attributes-START##
            ab initio :: 2% of CDS bases
            ##RefSeq-Attributes-END##
            COMPLETENESS: incomplete on the 3' end.
FEATURES             Location/Qualifiers
     source          1..455
                     /organism="Columba livia"
                     /mol_type="mRNA"
                     /db_xref="taxon:8932"
                     /chromosome="Unknown"
                     /sex="male"
                     /tissue_type="blood"
                     /country="Denmark: Vordingborg"
                     /collection_date="13-Jun-2010"
                     /breed="Danish Tumbler"
                     /note="bred by Anders Christiansen, Hans Ove Christiansen,
                     and certified by Danmarks Racedueforeninger"
     gene            1..>455
                     /gene="LOC102094641"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Gnomon. Supporting evidence
                     includes similarity to: 7 Proteins, and 97% coverage of
                     the annotated genomic feature by RNAseq alignments,
                     including 8 samples with support for all annotated
                     introns"
                     /db_xref="GeneID:102094641"
     CDS             1..>455
                     /gene="LOC102094641"
                     /codon_start=1
                     /product="cytochrome P450 2C31"
                     /protein_id="XP_005515932.1"
                     /db_xref="GeneID:102094641"
                     /translation="

MLWTFLFLSFQLYQMFSKILDYLPGPHNRVFAEIDALKAFVSEEMKMHKGSLDPSSPQDYIDCFLCKMQKEKKNPNSSFHMENLITSTFDLFIAGSETTSTTIRYGLLLLLKYPKIQEKVQEEIDQVVGRSRRPCVADRSQMPYTDAVLHE"

     misc_feature    <10..>455
                     /gene="LOC102094641"
                     /note="cytochrome P450 (CYP) superfamily; Region:
                     cytochrome_P450; cl41757"
                     /db_xref="CDD:425388"
ORIGIN      

atgctatggaccttcctgtttctttccttccagctctaccagatgttctcaaagatcctggattacttgcctggcccacacaacagagtgtttgcagaaatcgatgctctaaaagcctttgtgtcagaagagatgaagatgcacaaaggctccctagatcctagctcccctcaggattacattgactgcttcctctgcaaaatgcagaaggagaaaaagaatcccaactccagtttccacatggagaacctgataaccagcacctttgacttgttcattgccggatctgagacaactagcaccaccataagatatggacttctgcttcttctcaaatacccaaagatacaagagaaagttcaagaagagattgaccaggtagtgggacgatcacgaagaccttgtgtggctgaccggtcccagatgccctacacagatgcagtgctccatgaaat

//