LOCUS       XM_005440041            1563 bp    mRNA    linear   VRT 02-MAY-2023
DEFINITION  PREDICTED: Falco cherrug homeobox B8 (HOXB8), mRNA.
ACCESSION   XM_005440041
VERSION     XM_005440041.3
DBLINK      BioProject: PRJNA962077
KEYWORDS    RefSeq; corrected model.
SOURCE      Falco cherrug (Saker falcon)
  ORGANISM  Falco cherrug
            Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
            Archelosauria; Archosauria; Dinosauria; Saurischia; Theropoda;
            Coelurosauria; Aves; Neognathae; Neoaves; Telluraves; Australaves;
            Falconiformes; Falconidae; Falco.
COMMENT     MODEL REFSEQ:  This record is predicted by automated computational
            analysis. This record is derived from a genomic sequence
            (NC_073716) annotated using gene prediction method: Gnomon.
            Also see:
                Documentation of NCBI's Annotation Process
            
            On May 2, 2023 this sequence version replaced XM_005440041.2.
            
            ##Genome-Annotation-Data-START##
            Annotation Provider         :: NCBI RefSeq
            Annotation Status           :: Full annotation
            Annotation Name             :: GCF_023634085.1-RS_2023_04
            Annotation Pipeline         :: NCBI eukaryotic genome annotation
                                           pipeline
            Annotation Software Version :: 10.1
            Annotation Method           :: Best-placed RefSeq; Gnomon;
                                           cmsearch; tRNAscan-SE
            Features Annotated          :: Gene; mRNA; CDS; ncRNA
            Annotation Date             :: 04/26/2023
            ##Genome-Annotation-Data-END##
            
            ##RefSeq-Attributes-START##
            frameshifts :: corrected 1 indel
            ##RefSeq-Attributes-END##
PRIMARY     REFSEQ_SPAN         PRIMARY_IDENTIFIER PRIMARY_SPAN        COMP
            1-39                JAMOAL010000035.1  5440049-5440087     c
            40-421              JAMOAL010000035.1  5439666-5440047     c
            422-1563            JAMOAL010000035.1  5437744-5438885     c
FEATURES             Location/Qualifiers
     source          1..1563
                     /organism="Falco cherrug"
                     /mol_type="mRNA"
                     /isolate="bFalChe1"
                     /db_xref="taxon:345164"
                     /chromosome="20"
                     /sex="female"
                     /tissue_type="blood"
                     /dev_stage="adult"
                     /geo_loc_name="Qatar: Doha"
                     /lat_lon="25.286106 N 51.534817 E"
                     /collection_date="2020-02-12"
                     /collected_by="Farooq Omar Al-Ajli, Souq Waqif Falcon
                     Hospital"
     gene            1..1563
                     /gene="HOXB8"
                     /note="homeobox B8; The sequence of the model RefSeq
                     transcript was modified relative to its source genomic
                     sequence to represent the inferred CDS: deleted 1 base in
                     1 codon; Derived by automated computational analysis using
                     gene prediction method: Gnomon. Supporting evidence
                     includes similarity to: 16 Proteins"
                     /db_xref="GeneID:102054338"
     CDS             1..726
                     /gene="HOXB8"
                     /note="The sequence of the model RefSeq protein was
                     modified relative to its source genomic sequence to
                     represent the inferred CDS: deleted 1 base in 1 codon"
                     /codon_start=1
                     /product="LOW QUALITY PROTEIN: homeobox protein Hox-B8"
                     /protein_id="XP_005440098.2"
                     /db_xref="GeneID:102054338"
                     /translation="

MSSYFVNSLFSKYKPGDSLRPNYYDCGFAQDLGGRPTVVYGPSTGGTFQHPTQIQEFYHGASSLSSSPYQQNPCAVACHGDPSNFYGYDPLQRQSLFSAQESDLVQYTDCKLAASGLGEEAESSEQSPSPTQLFPWMRPQAAGRRRGRQTYSRYQTLELEKEFLFNPYLTRKRRIEVSHALGLTERQVKIWFQNRRMKWKKENNKDKFPSSKCEQEELEKQKMERAQEVDEEGEAQKADKK"

     misc_feature    433..603
                     /gene="HOXB8"
                     /note="Region: Homeodomain; pfam00046"
                     /db_xref="CDD:459649"
ORIGIN      

atgagctcttattttgtcaactcactcttctccaaatacaaaccgggggactccttgcgtcccaattactatgactgcgggttcgctcaggatcttgggggcagacccacggtggtgtacggacccagcacggggggcaccttccagcatccgacccaaatccaggagttttaccacggagcatcctcactctccagctccccttaccaacagaatccctgcgccgtggcgtgccatggggaccccagcaacttctatggctacgaccccttgcaaaggcagagcctcttcagcgcccaggagtcggacttggtgcagtacacggactgcaagcttgctgccagcggccttggagaggaggcggagagctcggagcagagcccttctccgacccagcttttcccctggatgcgaccgcaagccgctggacggaggagggggaggcaaacctacagccgctaccagacgctggaactggagaaggaatttctatttaatccctacctgacccgcaaacggaggatcgaggtctcgcatgccctgggattgacagaaaggcaggtcaaaatctggttccagaacaggaggatgaaatggaaaaaggaaaacaacaaagacaagtttcccagcagcaaatgcgagcaggaagaactggaaaaacagaaaatggaaagagcccaggaggtggacgaggaaggggaagcacagaaggcggacaagaaataaaaggatttttaaggactgaaaggcaagcactgctggggtggacgagcccctgagccccacgttaatggcagttaatgtaagggaggggtgggaaaaaaaacaacaatgcatagaaaagagaaaggaaaaaaacccaaccttttattgctgtaaaacaatatagctgtaagcaccactttcctgattatcctttgatacaatgaacagtatgcaaaagtgatcgggaggtctctcctgccttttgccagttattaactagtggtagtgtaacgcaatagcttatgtaaaacatgactgtgaaattttctctctctctctgtctttctctctgtctctctcttctttcctggggggggtgggttggttaacatagctttcaatgctataggagttacgtgaaattacatttgtgcactttttttttgttttaaattttccacctttttttgttgtggtttatctgtatgtactggaggtagctattgaaacaaacatcccaacaacatgaaactgcctatttatgctctagttatctctttctttctctctctttctctctttactttccctgcttctgttcttttctttggttcgggattttcttttttgtttgtttgggttttgtttacaattcttaaatgtctcttccaaaaaaaaaaaaaaaagggaaaaaaaggaaaaaaaaaagacaagaaaaaaagcgtttttctctcatttagttagcatgcgcacagtgaagcaagttgtaaagtgatctttaggttaactgtgaaaaagaatgtatactgtatacgtgaattactttattgggggaactaatgatatattttgttgttc

//