2025-10-17 05:22:27, GGRNA.v2 : RefSeq release 232 (Sep, 2025)
LOCUS XM_004695880 1062 bp mRNA linear MAM 10-JUN-2015 DEFINITION PREDICTED: Condylura cristata VCP-interacting membrane selenoprotein (VIMP), mRNA. ACCESSION XM_004695880 VERSION XM_004695880.2 DBLINK BioProject: PRJNA193510 KEYWORDS RefSeq. SOURCE Condylura cristata (star-nosed mole) ORGANISM Condylura cristata Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia; Eutheria; Laurasiatheria; Eulipotyphla; Talpidae; Condylura. COMMENT MODEL REFSEQ: This record is predicted by automated computational analysis. This record is derived from a genomic sequence (NW_004567136.1) annotated using gene prediction method: Gnomon, supported by mRNA evidence. Also see: Documentation of NCBI's Annotation Process On Jun 10, 2015 this sequence version replaced XM_004695880.1. ##Genome-Annotation-Data-START## Annotation Provider :: NCBI Annotation Status :: Full annotation Annotation Version :: Condylura cristata Annotation Release 101 Annotation Pipeline :: NCBI eukaryotic genome annotation pipeline Annotation Software Version :: 6.3 Annotation Method :: Best-placed RefSeq; Gnomon Features Annotated :: Gene; mRNA; CDS; ncRNA ##Genome-Annotation-Data-END## FEATURES Location/Qualifiers source 1..1062 /organism="Condylura cristata" /mol_type="mRNA" /isolate="star-nosed mole 26May11" /db_xref="taxon:143302" /chromosome="Unknown" /sex="female" gene 1..1062 /gene="VIMP" /note="Derived by automated computational analysis using gene prediction method: Gnomon. Supporting evidence includes similarity to: 8 mRNAs, 11 Proteins, and 100% coverage of the annotated genomic feature by RNAseq alignments, including 3 samples with support for all annotated introns" /db_xref="GeneID:101636247" CDS 43..606 /gene="VIMP" /codon_start=1 /product="selenoprotein S" /protein_id="XP_004695937.2" /db_xref="GeneID:101636247" /translation="
MEPDGEQLAARPALETEGLRFLHVTVGSLLATYGWYILFSCILLYVVFQKLSTRLRVLRQRQLDQAAAAVEPDVVVKRQEALAAARLKMQEELNAQVEKHKEKLKQLEEEKRRQKIEMWDSMQEGKSYRGSARKPQEEDSPGPSTSVIPKRKPDRKPLRGGGYNPLSGEGGGACSWRPGRRGPTSGG"
misc_feature 46..603 /gene="VIMP" /note="Selenoprotein S (SelS); Region: Selenoprotein_S; pfam06936" /db_xref="CDD:462043" ORIGIN
cgcagtctcgagctgacgcggctgggcagcttggcggcggccatggagccggacggggagcagctggccgcgcggccagccctggagacagaggggctgcgcttcctgcacgtcacggtgggctccctgctggccacctatggctggtacatcctcttcagctgcatcctcctctacgtggtctttcagaagctctccacccggctgagggtcttgaggcagaggcagctggaccaggctgcagcagctgtggagcctgatgttgttgttaaacggcaagaggctttagcagctgctcgtttgaaaatgcaagaggaattaaatgcccaagttgaaaaacataaagaaaaactaaaacagcttgaagaagaaaaaagaagacagaagatagaaatgtgggacagcatgcaagaggggaaaagctacagaggaagcgcaaggaagccgcaggaggaagacagccctgggccttccacttcagtcatccccaaacgaaaacccgacaggaagcctttgcgaggaggcgggtacaaccctttgtctggtgaaggagggggagcctgctcctggagacccggacgcagaggcccgacatctggtggatgaggctaagagtcttgttagtgtcgtctttgacattagcaagaagaatccttaaccctcaattcaactgcctcaacgcacacttttcacagtgactagccagggagtggagtttctttcttttcttagctttacctttaagggagaaagccagcacaccagaatcagtagatcattggccacacttcactaaatctattcattggtttatggtaattgctagttagtaggtgaacgcctctaggtgatgagcaattttgacgaaagagttggatttctaaggctggcaggtagggcgtgtctgtgacgggtgcgttgaatgatgtcttcctcggaaacggtgagccaccggtgaggattactgatgcagacagttattgaggtagtttctgtatatttgtttttatgtacagaactttgtagaaaacttgtaaatattaaaacaatgcaaaaaccgtt
//
by
@meso_cacase at
DBCLS
This page is licensed under a
Creative Commons Attribution 4.0 International License (CC BY 4.0).
If you use GGRNA in your work, please cite:
Naito Y, Bono H. (2012)
GGRNA: an ultrafast, transcript-oriented search engine for genes and transcripts.
Nucleic Acids Res., 40, W592-W596.
[Full Text]