2025-07-04 00:18:09, GGRNA.v2 : RefSeq release 229 (Mar, 2025)
LOCUS XM_004092297 1226 bp mRNA linear PRI 17-SEP-2019 DEFINITION PREDICTED: Nomascus leucogenys claudin 17 (CLDN17), mRNA. ACCESSION XM_004092297 VERSION XM_004092297.3 DBLINK BioProject: PRJNA564096 KEYWORDS RefSeq. SOURCE Nomascus leucogenys (northern white-cheeked gibbon) ORGANISM Nomascus leucogenys Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hylobatidae; Nomascus. COMMENT MODEL REFSEQ: This record is predicted by automated computational analysis. This record is derived from a genomic sequence (NC_044405.1) annotated using gene prediction method: Gnomon, supported by mRNA evidence. Also see: Documentation of NCBI's Annotation Process On Sep 17, 2019 this sequence version replaced XM_004092297.2. ##Genome-Annotation-Data-START## Annotation Provider :: NCBI Annotation Status :: Full annotation Annotation Name :: Nomascus leucogenys Annotation Release 103 Annotation Version :: 103 Annotation Pipeline :: NCBI eukaryotic genome annotation pipeline Annotation Software Version :: 8.2 Annotation Method :: Best-placed RefSeq; Gnomon Features Annotated :: Gene; mRNA; CDS; ncRNA ##Genome-Annotation-Data-END## FEATURES Location/Qualifiers source 1..1226 /organism="Nomascus leucogenys" /mol_type="mRNA" /isolate="Asia" /bio_material="CORIELL:NLL605" /db_xref="taxon:61853" /chromosome="25" /sex="female" /tissue_type="EB transformed lymphoblast cell line" /dev_stage="adult" gene 1..1226 /gene="CLDN17" /note="Derived by automated computational analysis using gene prediction method: Gnomon. Supporting evidence includes similarity to: 3 mRNAs, 2 Proteins" /db_xref="GeneID:100597196" CDS 183..857 /gene="CLDN17" /codon_start=1 /product="claudin-17" /protein_id="XP_004092345.2" /db_xref="GeneID:100597196" /translation="
MAFYPLQIAGLVLGFLGMVGTLATTLLPQWRVSAFVGSNIIVFERLWEGLWMNCIRQARVRLQCKFYSSLLALPPALETARALMCVAVALSLIALLLGICGMKQVQCTGSNERAKAYLLGTSGVLFILTGIFVLIPVSWTASIIIRDFYNPAIHIGQKRELGAALFLGWASAAVLFIGGGLLCGFCCCNRKKQGYGYPVPGYCVPHTDKRRNRTMLSKTSTSYV"
misc_feature 198..728 /gene="CLDN17" /note="PMP-22/EMP/MP20/Claudin family; Region: PMP22_Claudin; cl21598" /db_xref="CDD:473919" ORIGIN
ttacaacaggtacttctagttaggccaagttcagtcacagctactgatttggactgaaacgttatgggcagcagccaagaagaacatcatcaaagacttctctggactcaaaaggcttccacgttctacatcttgagcatcttctaccactccgaattgaaccagtcttcaaagtaaaggcaatggcattttatcccttgcaaattgctgggctggttcttgggttccttggcatggtggggactcttgccacaacccttctgcctcagtggagagtatcagcttttgttggcagcaacattattgtctttgagaggctctgggaagggctctggatgaactgcatccgacaagccagggtccggttgcaatgcaagttctatagttccttgttggctctcccgcctgccctggaaacagcccgggccctcatgtgtgtggctgttgctctctccttgatcgccctacttcttggcatctgtggcatgaagcaggtccagtgcacaggctctaacgagagggccaaagcataccttctgggaacttcaggagtcctcttcatcctgacgggcatcttcgttctgattccggtgagctggacagccagtataatcatcagagatttctacaacccagccattcacataggtcagaaacgagagctgggagcagcacttttccttggctgggcaagcgctgctgtcctcttcattggagggggtctgctttgtggattttgctgctgtaacagaaagaaacaagggtacggatatccagtgcctggctactgtgtgccacacacagataagcgaagaaacaggacaatgcttagtaagacctccaccagttatgtctaatgcccccttttggctccaagtatggactacggtcaatgtttttttataaagtgctgctagaaactgtaagtatgtgaggcaggagaacttgctttatgtctagatttaaactgatatgaaagtttcaatttgttactggtggtaggaatggaaatgacttacttggacattctgacttcaggtgtattaaatgcattgactattgttggactcaatcgctgttccaattttcatattctaaattcaagtatgcccataatcattggcaagtgtacaatgatggactactactttttgaccatcatatattatctgataagaatctaaagttgaaattgatattctataacaataaaacatatacctatt
//
by
@meso_cacase at
DBCLS
This page is licensed under a
Creative Commons Attribution 4.0 International License (CC BY 4.0).
If you use GGRNA in your work, please cite:
Naito Y, Bono H. (2012)
GGRNA: an ultrafast, transcript-oriented search engine for genes and transcripts.
Nucleic Acids Res., 40, W592-W596.
[Full Text]