2025-07-02 11:04:22, GGRNA.v2 : RefSeq release 229 (Mar, 2025)
LOCUS NM_204201 1752 bp mRNA linear VRT 23-SEP-2023 DEFINITION Gallus gallus claudin 5 (CLDN5), mRNA. ACCESSION NM_204201 VERSION NM_204201.2 KEYWORDS RefSeq. SOURCE Gallus gallus (chicken) ORGANISM Gallus gallus Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Archelosauria; Archosauria; Dinosauria; Saurischia; Theropoda; Coelurosauria; Aves; Neognathae; Galloanserae; Galliformes; Phasianidae; Phasianinae; Gallus. REFERENCE 1 (bases 1 to 1752) AUTHORS Tang H, Finn RD and Thomas PD. TITLE TreeGrafter: phylogenetic tree-based annotation of proteins with Gene Ontology terms and other annotations JOURNAL Bioinformatics 35 (3), 518-520 (2019) PUBMED 30032202 REFERENCE 2 (bases 1 to 1752) AUTHORS Collins MM, Baumholtz AI and Ryan AK. TITLE Claudin-5 expression in the vasculature of the developing chick embryo JOURNAL Gene Expr Patterns 12 (3-4), 123-129 (2012) PUBMED 22326481 REMARK GeneRIF: Claudin-5 is the only endothelial claudin expressed during chick development. REFERENCE 3 (bases 1 to 1752) AUTHORS Burge S, Kelly E, Lonsdale D, Mutowo-Muellenet P, McAnulla C, Mitchell A, Sangrador-Vegas A, Yong SY, Mulder N and Hunter S. TITLE Manual GO annotation of predictive protein signatures: the InterPro approach to GO curation JOURNAL Database (Oxford) 2012, bar068 (2012) PUBMED 22301074 REMARK Publication Status: Online-Only REFERENCE 4 (bases 1 to 1752) AUTHORS Rizzolo LJ, Chen X, Weitzman M, Sun R and Zhang H. TITLE Analysis of the RPE transcriptome reveals dynamic changes during the development of the outer blood-retinal barrier JOURNAL Mol Vis 13, 1259-1273 (2007) PUBMED 17679949 REMARK Publication Status: Online-Only COMMENT VALIDATED REFSEQ: This record has undergone validation or preliminary review. The reference sequence was derived from JAENSK010000260.1. On Oct 5, 2021 this sequence version replaced NM_204201.1. ##Evidence-Data-START## Transcript is intronless :: AF334678.1, CO421331.1 [ECO:0000345] ##Evidence-Data-END## PRIMARY REFSEQ_SPAN PRIMARY_IDENTIFIER PRIMARY_SPAN COMP 1-1752 JAENSK010000260.1 722599-724350 c FEATURES Location/Qualifiers source 1..1752 /organism="Gallus gallus" /mol_type="mRNA" /db_xref="taxon:9031" /chromosome="15" /map="15" gene 1..1752 /gene="CLDN5" /note="claudin 5" /db_xref="CGNC:49011" /db_xref="GeneID:374028" exon 1..1752 /gene="CLDN5" /inference="alignment:Splign:2.1.0" CDS 90..740 /gene="CLDN5" /codon_start=1 /product="claudin-5" /protein_id="NP_989532.1" /db_xref="CGNC:49011" /db_xref="GeneID:374028" /translation="
MASAAVEILGLGLGILGWVGVILACGLPMWQVSAFIDVNIVVAQTIWEGLWMNCVVQSTGQMQCKVYDSILALRPEVQAGRALTVIVALLGLVALMVTVVGAQCTNCIRPGKMKSRIVIAGGTIYILCGVLVLVPLCWFANIVISDFYDPSVPPSQKREIGAALYIGWAATALLLFGGCLICCCSCLQRDETSFPVKYSAPRRPTSSGEYDKKNYV"
misc_feature 177..629 /gene="CLDN5" /note="PMP-22/EMP/MP20/Claudin family; Region: PMP22_Claudin; cl21598" /db_xref="CDD:473919" ORIGIN
agagcggctcggcagttgtggccggggtcggaggtgcggagccgctgtcctttccccgcgggtttccgaagagcagcggcagcggcggcatggcttcggcggcggtggagattttggggctgggactgggcatcctgggctgggtgggggtgatcctggcctgcgggctgcccatgtggcaggtgtcagccttcatcgacgtgaacatcgtggtggcgcagaccatctgggaagggctgtggatgaactgcgtggtgcagagcacggggcagatgcagtgcaaggtgtacgattccatcctggcgctgcggccggaggtgcaggcgggccgggcgctcacggtcatcgtggcgctgctggggctggtggcgctcatggtcaccgtggtgggcgcgcagtgcaccaactgcatccggcccggcaagatgaagtcccgcatcgtgatcgccggagggaccatctacatcctctgcggggtcctggtcctcgtcccgctctgctggttcgccaacatcgtcatcagcgacttctacgacccctccgtgccgccgtcccagaagcgggagataggggccgcgctgtacatcggctgggcggccacggctctgctgcttttcgggggctgcctcatctgctgctgctcctgcttgcagcgcgacgagacctccttccccgtcaagtactcggcgccgcggcggcccacctccagcggcgagtacgacaagaagaactacgtctgagcggggccgcccgctccgcccggtcgtgcgggcacacggacagacggcgccgccggccgggagcgactgcggtgagctcggccgacgggcgccgcggcgctcctcatcccggagcccgcccagccgcggcaccacagcggcggcagccccgggcagagcggcgtcctgccggcccgcctctccgtcggagcgccgcgtcgggtcctgcccctgcccagcccggccagcgctgcccggcccggcggcaccgccgcgctgctggagcggagccgggagtggtgcggagccgctggtgcctctctgcgcgctgccgggccgtcgtgcgtgccctgtcggggaggagaagcttcccttcttcgttctatctcctgaaaacctgcagctgactgacttctgccatggctttaactggttaaggtttttccttttgttctttgtgggcagctaaactcgggttcctatctgaaggaagactctaaccttggtccttaatcatgcaggcaaataactgcttggagaaaggcacgtcgttttgttccgttgttttgggccctcaaagcgctgatctgtgcgcctttgagacttttgaaagtgatttcagatagctgctgttgctcagcagagaacaaaagccattattccaggttctccatcacttctccttcgtcagcttctgtccttcttgtacttgaatacgaactcattgcaggtcgccagagatacagggggactaaatgcagagacctgggagatctttgtgccctggctccagcacggcgtccctctgtgcctctcgtctgtactacaggagactggaaacaaacctttccctcgctcgtgatgcttaggctatgagaggcttcgtggccttcttgctgagcacttctcgctgccaaatctgaatcacatgtgctcagctggacatacacatgctcggctccccactgtaacttcggtaacatgcacttgccttaatttaattaatcgggcaaataaattaaatgctagagga
//
by
@meso_cacase at
DBCLS
This page is licensed under a
Creative Commons Attribution 4.0 International License (CC BY 4.0).
If you use GGRNA in your work, please cite:
Naito Y, Bono H. (2012)
GGRNA: an ultrafast, transcript-oriented search engine for genes and transcripts.
Nucleic Acids Res., 40, W592-W596.
[Full Text]