2024-04-20 20:48:44, GGRNA.v2 : RefSeq release 222 (Jan, 2024)
LOCUS NM_131764 1863 bp mRNA linear VRT 25-MAR-2023 DEFINITION Danio rerio claudin 3d (cldn3d), mRNA. ACCESSION NM_131764 VERSION NM_131764.1 KEYWORDS RefSeq. SOURCE Danio rerio (zebrafish) ORGANISM Danio rerio Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Actinopterygii; Neopterygii; Teleostei; Ostariophysi; Cypriniformes; Danionidae; Danioninae; Danio. REFERENCE 1 (bases 1 to 1863) AUTHORS Liu Y, Kossack ME, McFaul ME, Christensen LN, Siebert S, Wyatt SR, Kamei CN, Horst S, Arroyo N, Drummond IA, Juliano CE and Draper BW. TITLE Single-cell transcriptome reveals insights into the development and function of the zebrafish ovary JOURNAL Elife 11, e76014 (2022) PUBMED 35588359 REMARK Publication Status: Online-Only REFERENCE 2 (bases 1 to 1863) AUTHORS Lukowicz-Bedford RM, Farnsworth DR and Miller AC. TITLE Connexinplexity: the spatial and temporal expression of connexin genes during vertebrate organogenesis JOURNAL G3 (Bethesda) 12 (5) (2022) PUBMED 35325106 REFERENCE 3 (bases 1 to 1863) AUTHORS Metikala S, Casie Chetty S and Sumanas S. TITLE Single-cell transcriptome analysis of the zebrafish embryonic trunk JOURNAL PLoS One 16 (7), e0254024 (2021) PUBMED 34234366 REMARK Publication Status: Online-Only REFERENCE 4 (bases 1 to 1863) AUTHORS Luo T, Wang X and Jin Y. TITLE Low concentrations of imidacloprid exposure induced gut toxicity in adult zebrafish (Danio rerio) JOURNAL Comp Biochem Physiol C Toxicol Pharmacol 241, 108972 (2021) PUBMED 33418081 REFERENCE 5 (bases 1 to 1863) AUTHORS Solis CJ, Hamilton MK, Caruffo M, Garcia-Lopez JP, Navarrete P, Guillemin K and Feijoo CG. TITLE Intestinal Inflammation Induced by Soybean Meal Ingestion Increases Intestinal Permeability and Neutrophil Turnover Independently of Microbiota in Zebrafish JOURNAL Front Immunol 11, 1330 (2020) PUBMED 32793187 REMARK Publication Status: Online-Only REFERENCE 6 (bases 1 to 1863) AUTHORS Kumai Y, Bahubeshi A, Steele S and Perry SF. TITLE Strategies for maintaining Na balance in zebrafish (Danio rerio) during prolonged exposure to acidic water JOURNAL Comp Biochem Physiol A Mol Integr Physiol 160 (1), 52-62 (2011) PUBMED 21600298 REFERENCE 7 (bases 1 to 1863) AUTHORS Clelland ES and Kelly SP. TITLE Tight junction proteins in zebrafish ovarian follicles: stage specific mRNA abundance and response to 17beta-estradiol, human chorionic gonadotropin, and maturation inducing hormone JOURNAL Gen Comp Endocrinol 168 (3), 388-400 (2010) PUBMED 20553723 REFERENCE 8 (bases 1 to 1863) AUTHORS Feng L, Hernandez RE, Waxman JS, Yelon D and Moens CB. TITLE Dhrs3a regulates retinoic acid biosynthesis through a feedback inhibition mechanism JOURNAL Dev Biol 338 (1), 1-14 (2010) PUBMED 19874812 REFERENCE 9 (bases 1 to 1863) AUTHORS Stuckenholz C, Lu L, Thakur P, Kaminski N and Bahary N. TITLE FACS-assisted microarray profiling implicates novel genes and pathways in zebrafish gastrointestinal tract development JOURNAL Gastroenterology 137 (4), 1321-1332 (2009) PUBMED 19563808 REFERENCE 10 (bases 1 to 1863) AUTHORS Loh YH, Christoffels A, Brenner S, Hunziker W and Venkatesh B. TITLE Extensive expansion of the claudin gene family in the teleost fish, Fugu rubripes JOURNAL Genome Res 14 (7), 1248-1257 (2004) PUBMED 15197168 COMMENT PROVISIONAL REFSEQ: This record has not yet been subject to final NCBI review. The reference sequence was derived from AF359432.1. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Gene record to access additional publications. ##Evidence-Data-START## Transcript exon combination :: AF359432.1 [ECO:0000332] ##Evidence-Data-END## FEATURES Location/Qualifiers source 1..1863 /organism="Danio rerio" /mol_type="mRNA" /db_xref="taxon:7955" /chromosome="21" /map="21" gene 1..1863 /gene="cldn3d" /gene_synonym="cldnc" /note="claudin 3d" /db_xref="GeneID:81582" /db_xref="ZFIN:ZDB-GENE-010328-3" exon 1..1844 /gene="cldn3d" /gene_synonym="cldnc" /inference="alignment:Splign:2.1.0" misc_feature 148..150 /gene="cldn3d" /gene_synonym="cldnc" /note="upstream in-frame stop codon" CDS 316..972 /gene="cldn3d" /gene_synonym="cldnc" /note="claudin c" /codon_start=1 /product="claudin 3d" /protein_id="NP_571839.1" /db_xref="GeneID:81582" /db_xref="ZFIN:ZDB-GENE-010328-3" /translation="
MASFGLELVGVTLSVLGWILNIVCCALPMWRVTAFIGTNIVTAQVYWEGIWMSCVVQSTGQMQCKVYDSMLALPADLQAARALVVVAIIVGVLALFVAIVGAKCTNCIEEEAAKARVMISSGAAFITASVLQLIPVCWSAHTVILEFYSPLVPEAQKMEIGASLYLGWAASAMLLVGGSILCCSCPPKDETRYPPQSRIAYSAHHSVAPSTYNKRDYV"
misc_feature 328..858 /gene="cldn3d" /gene_synonym="cldnc" /note="PMP-22/EMP/MP20/Claudin family; Region: PMP22_Claudin; cl21598" /db_xref="CDD:451326" ORIGIN
aacagaaagcagctccccttttttattaggacgccaaccaatacttgaatcgcaccttatcatctgatgtcagaaggcaggtaactcagcccttttctcagaaaaggggaagtttctaccaggacagaacattccagccgtccttgttgaggagattcagtgtgtcaacacccacctccatgcctgaacggtcttttggtgattttggagatttctgatgtaattgtctcaaggacttgggcagactttgtgagagcttcagcgagcataagagaaagcaaactgaacattcaacaggagaaagagactggagacatggcgtcttttggtttggagttagtaggtgtcacgctctcagtccttggctggattctcaacattgtttgctgtgctttgcccatgtggagggtcacggcgttcatcggcaccaatatcgtcacagcacaggtgtactgggagggaatctggatgagctgtgtggttcaaagcaccggacagatgcaatgtaaagtctatgactccatgctggctcttcctgcagatctacaggcggctcgcgctctggtggtggtggccatcattgtcggtgtccttgcgctttttgtggctattgtgggagccaaatgcaccaactgcattgaggaggaagcagccaaagcccgtgtgatgatcagctctggagccgctttcataactgcttcagtcttgcagcttattcctgtgtgctggtctgcacatacggtcattcttgagttctacagcccgctggtaccagaagctcagaagatggaaattggagcatcgctgtatctgggctgggctgcttcggcaatgttgcttgttggaggatcaatactgtgctgcagttgcccaccaaaagatgagacgaggtaccctccgcaaagtcgtatcgcctattcagcccaccactcagtggctccaagtacctataacaagagagactatgtctgagaagctcagaggacatttgttttgtagctgtcagtctttccttgaaagataattgtaaacatgtgtgttggaggtaactcagtattgtttacttttgctccatgtaaaagttttggttttgtccattgtcactccacaatgtagttttataattcattttgctgtagttctctgttaggattgcgtttcaaaatccattatataagttgatttaaagtgagaaaatgtcagtgcttatatttgtgtagccttgtgggctttcgttttttgttatttttcagtttttactctttcaccaaagctagttgagaataaatatttttatactttcatctaaaagaattaaacacgatctgctaatccttgaatcgagaaatcttttactaatatgcttgtacattgcttgagttgtgatcaagtctgtaaatgtttagttgtgtctaatgtttatttcagtattgttcttgtttttattcactgaagtgctcaaaaatggacagagaagagtttagatatggaacatgtctagagagcaactttatccttttcgttttcctctcctatctgtgtacgtgttacaaaatacaatactagtgaatgtatgtaaaactacaaaatgggaaaatgtttttgatttatttccctcattcaagagacagaaaaaaagactgaattcaagctcctctggacaaaacaactctgagaaactctgagactctgtgcaggcacctcccaaagtttcctcacattatatactttgcacactttcatgtttgttgtcgttgttttcagcactaccatgtatcttaatagccttgtgataaccattttcacttaaattgttgattattaaatatatatcagtgatgaaaaaaaaaaaaaaaaaaaaaa
//
by
@meso_cacase at
DBCLS
This page is licensed under a
Creative Commons Attribution 4.0 International License (CC BY 4.0).
If you use GGRNA in your work, please cite:
Naito Y, Bono H. (2012)
GGRNA: an ultrafast, transcript-oriented search engine for genes and transcripts.
Nucleic Acids Res., 40, W592-W596.
[Full Text]